SBF2 Antibody


Western Blot: SBF2 Antibody [NBP2-13283] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: SBF2 Antibody [NBP2-13283] - Staining of human cervix, uterine shows moderate nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SBF2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NQAPEKWQQLWERVTVDLKEEPRTDRSQRHLSRSPGIVSTNLPSYQKRSL LHLPDSSMGEEQNSSISPSNGVERR
Specificity of human SBF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SBF2 Protein (NBP2-13283PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SBF2 Antibody

  • Charcot-Marie-Tooth neuropathy 4B2 (autosomal recessive, with myelinoutfolding)
  • CMT4B2myotubularin related 13
  • DKFZp779B2327
  • KIAA1766FLJ41627
  • MTMR13FLJ22918
  • myotubularin-related protein 13
  • SET binding factor 2
  • SET-binding factor 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SBF2 Antibody (NBP2-13283) (0)

There are no publications for SBF2 Antibody (NBP2-13283).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SBF2 Antibody (NBP2-13283) (0)

There are no reviews for SBF2 Antibody (NBP2-13283). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SBF2 Antibody (NBP2-13283) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SBF2 Products

Bioinformatics Tool for SBF2 Antibody (NBP2-13283)

Discover related pathways, diseases and genes to SBF2 Antibody (NBP2-13283). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SBF2 Antibody (NBP2-13283)

Discover more about diseases related to SBF2 Antibody (NBP2-13283).

Pathways for SBF2 Antibody (NBP2-13283)

View related products by pathway.

PTMs for SBF2 Antibody (NBP2-13283)

Learn more about PTMs related to SBF2 Antibody (NBP2-13283).

Blogs on SBF2

There are no specific blogs for SBF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SBF2 Antibody and receive a gift card or discount.


Gene Symbol SBF2