LIMPII/SR-B2 Antibody (7D2P5) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SR-B2/LIMPII/SR-B2 (Q14108). MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANI |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
SCARB2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for LIMPII/SR-B2 Antibody (7D2P5)
Background
High density lipoproteins (HDLs) play a critical role in cholesterol metabolism and their plasma concentrations are inversely correlated with risk for atherosclerosis. SR-BI and SR-BII (previously known as SR-BI.2) are the alternatively spliced products of a single gene. SR-BII differs from SR-BI in that the encoded c-terminal cytoplasmic domain is almost completely different. SR-BII binds HDLs and mediates selective uptake of HDL cholesteryl ester, but with an approximately 4-fold lower efficiency than SR-BI. Nuclease protection assays show SR-BII to be abundant in mouse tissues expressing SR-BI, with SR-BII expression found in liver, adrenal glands, and testes. Although the role of SR-BII is not completely clear, research suggests that it may be a functional HDL receptor. In addition, SR-BII mRNA results from the alternative splicing of SR-BI precursor transcripts with the SR-BII isoform mediating selective transfer of lipid between HDL and cells. The relative expression and functional activities of these two isoforms create a potential means of regulating selective lipid transfer between HDL and cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, Simple Western, WB
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Av, Bv, Sh
Applications: WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for LIMPII/SR-B2 Antibody (NBP3-16779) (0)
There are no publications for LIMPII/SR-B2 Antibody (NBP3-16779).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LIMPII/SR-B2 Antibody (NBP3-16779) (0)
There are no reviews for LIMPII/SR-B2 Antibody (NBP3-16779).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LIMPII/SR-B2 Antibody (NBP3-16779) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LIMPII/SR-B2 Products
Research Areas for LIMPII/SR-B2 Antibody (NBP3-16779)
Find related products by research area.
|
Blogs on LIMPII/SR-B2