LIMPII/SR-B2 Antibody (7D2P5)

Western Blot: LIMPII/SR-B2 Antibody (7D2P5) [NBP3-16779] - Western blot analysis of extracts of various cell lines, using SR-B2/LIMPII/SR-B2 Rabbit mAb (NBP3-16779) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry: LIMPII/SR-B2 Antibody (7D2P5) [NBP3-16779] - Immunohistochemistry analysis of LIMPII/SR-B2 in paraffin-embedded human liver tissue using LIMPII/SR-B2 Rabbit mAb at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: LIMPII/SR-B2 Antibody (7D2P5) [NBP3-16779] - Immunohistochemistry analysis of LIMPII/SR-B2 in paraffin-embedded mouse kidney tissue using LIMPII/SR-B2 Rabbit mAb at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: LIMPII/SR-B2 Antibody (7D2P5) [NBP3-16779] - Immunohistochemistry analysis of LIMPII/SR-B2 in paraffin-embedded Human lung adenocarcinoma tissue using LIMPII/SR-B2 Rabbit mAb at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: LIMPII/SR-B2 Antibody (7D2P5) [NBP3-16779] - Immunohistochemistry analysis of LIMPII/SR-B2 in paraffin-embedded human thyroid cancer tissue using LIMPII/SR-B2 Rabbit mAb at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: LIMPII/SR-B2 Antibody (7D2P5) [NBP3-16779] - Immunohistochemistry analysis of LIMPII/SR-B2 in paraffin-embedded mouse spleen tissue using LIMPII/SR-B2 Rabbit mAb at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: LIMPII/SR-B2 Antibody (7D2P5) [NBP3-16779] - Immunohistochemistry analysis of LIMPII/SR-B2 in paraffin-embedded rat kidney tissue using LIMPII/SR-B2 Rabbit mAb at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 7D2P5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

LIMPII/SR-B2 Antibody (7D2P5) Summary

• Description: Novus Biologicals Rabbit LIMPII/SR-B2 Antibody (7D2P5) (NBP3-16779) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SR-B2/LIMPII/SR-B2 (Q14108). MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANI
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SCARB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LIMPII/SR-B2 Antibody (7D2P5)

• AMRF
• CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2(lysosomal integral membrane protein II)
• CD36 antigen
• CD36L2
• CD36L2LIMP II
• HLGP85
• LGP85
• LIMP-2,85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2
• LIMPII
• LIMPIICD36 antigen-like 2
• LPG85
• lysosome membrane protein 2
• Lysosome membrane protein II
• SCARB2
• Scavenger receptor class B member 2,85 kDa lysosomal membrane sialoglycoprotein
• scavenger receptor class B, member 2
• SRB2
• SR-B2
• SR-BII

Background

High density lipoproteins (HDLs) play a critical role in cholesterol metabolism and their plasma concentrations are inversely correlated with risk for atherosclerosis. SR-BI and SR-BII (previously known as SR-BI.2) are the alternatively spliced products of a single gene. SR-BII differs from SR-BI in that the encoded c-terminal cytoplasmic domain is almost completely different. SR-BII binds HDLs and mediates selective uptake of HDL cholesteryl ester, but with an approximately 4-fold lower efficiency than SR-BI. Nuclease protection assays show SR-BII to be abundant in mouse tissues expressing SR-BI, with SR-BII expression found in liver, adrenal glands, and testes. Although the role of SR-BII is not completely clear, research suggests that it may be a functional HDL receptor. In addition, SR-BII mRNA results from the alternative splicing of SR-BI precursor transcripts with the SR-BII isoform mediating selective transfer of lipid between HDL and cells. The relative expression and functional activities of these two isoforms create a potential means of regulating selective lipid transfer between HDL and cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCARB2