LIAS Antibody

Images

 
Western Blot: LIAS Antibody [NBP1-54320] - LN18 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIAS Antibody Summary

Immunogen
Synthetic peptides corresponding to LIAS(lipoic acid synthetase) The peptide sequence was selected from the C terminal of LIAS. Peptide sequence EYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIAS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against LIAS and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LIAS Antibody

  • EC 2.8.1.8
  • LASmitochondrial
  • LIP1
  • lipoic acid synthetase
  • Lip-syn
  • MGC23245

Background

LIAS belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis.The protein encoded by this gene belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-39087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7665
Species: Hu
Applications: IHC, WB
NBP1-56929
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
664-LI/CF
Species: Hu
Applications: BA
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB

Publications for LIAS Antibody (NBP1-54320) (0)

There are no publications for LIAS Antibody (NBP1-54320).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIAS Antibody (NBP1-54320) (0)

There are no reviews for LIAS Antibody (NBP1-54320). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIAS Antibody (NBP1-54320) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIAS Products

Array NBP1-54320

Bioinformatics Tool for LIAS Antibody (NBP1-54320)

Discover related pathways, diseases and genes to LIAS Antibody (NBP1-54320). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIAS Antibody (NBP1-54320)

Discover more about diseases related to LIAS Antibody (NBP1-54320).
 

Pathways for LIAS Antibody (NBP1-54320)

View related products by pathway.

PTMs for LIAS Antibody (NBP1-54320)

Learn more about PTMs related to LIAS Antibody (NBP1-54320).

Blogs on LIAS

There are no specific blogs for LIAS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIAS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIAS
Uniprot