LCoR Antibody

Images

 
Western Blot: LCoR Antibody [NBP1-80260] - SP2/0 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LCoR Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of mouse A630025C20RIK. Peptide sequence QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCOR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against A630025C20RIK and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LCoR Antibody

  • FLJ38026
  • KIAA1795RP11-175O19.1
  • LCoR
  • ligand dependent nuclear receptor corepressor
  • Mblk1-related protein 2
  • MLR2
  • MLR2ligand-dependent corepressor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13674
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-82036
Species: Hu
Applications: IHC, IHC-P
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NB300-562
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-75453
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-67891
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF3499
Species: Hu
Applications: WB
NBP2-75672
Species: Hu
Applications: IHC, IHC-P, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB100-1669
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for LCoR Antibody (NBP1-80260) (0)

There are no publications for LCoR Antibody (NBP1-80260).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LCoR Antibody (NBP1-80260) (0)

There are no reviews for LCoR Antibody (NBP1-80260). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LCoR Antibody (NBP1-80260) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LCoR Products

Bioinformatics Tool for LCoR Antibody (NBP1-80260)

Discover related pathways, diseases and genes to LCoR Antibody (NBP1-80260). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LCoR Antibody (NBP1-80260)

Discover more about diseases related to LCoR Antibody (NBP1-80260).
 

Pathways for LCoR Antibody (NBP1-80260)

View related products by pathway.

Blogs on LCoR

There are no specific blogs for LCoR, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LCoR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LCOR
Uniprot