LCoR Antibody - BSA Free

Western Blot: LCoR Antibody [NBP1-80260] - SP2/0 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LCoR Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of mouse A630025C20RIK. Peptide sequence QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LCOR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LCoR Antibody - BSA Free

• FLJ38026
• KIAA1795RP11-175O19.1
• LCoR
• ligand dependent nuclear receptor corepressor
• Mblk1-related protein 2
• MLR2
• MLR2ligand-dependent corepressor

Background

LCOR is a transcriptional corepressor widely expressed in fetal and adult tissues that is recruited to agonist-bound nuclear receptors through a single LxxLL motif, also referred to as a nuclear receptor (NR) box (Fernandes et al., 2003 [PubMed 12535528]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LCOR
• Uniprot:
  • NP_742166(Mouse)