LCORL Antibody

Images

 
Immunohistochemistry: LCORL Antibody [NBP1-82036] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

LCORL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TYLHQLTLQKMVTQFKEKNESLQYETSNPTVQLKIPQLRVSSVSKSQPDGSGLLDVMYQVSKTSSVLEGSALQKLKNILPKQNKIECSGPVTHSSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCORL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
LCORL Protein (NBP1-82036PEP)

Alternate Names for LCORL Antibody

  • FLJ30696
  • LCoR-like protein
  • ligand dependent nuclear receptor corepressor-like
  • ligand-dependent nuclear receptor corepressor-like protein
  • MLR1MBLK1-related protein
  • transcription factor MLR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83477
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00064151-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49202
Species: Hu
Applications: IHC
NBP2-21005
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-90766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB170R
Species: Hu
Applications: Flow, Neut
NBP1-88447
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-33665
Species: Hu
Applications: WB
NBP2-02401
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32439
Species: Hu
Applications: WB
NBP2-46390
Species: Hu
Applications: WB, IHC
NBP1-82964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for LCORL Antibody (NBP1-82036) (0)

There are no publications for LCORL Antibody (NBP1-82036).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LCORL Antibody (NBP1-82036) (0)

There are no reviews for LCORL Antibody (NBP1-82036). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LCORL Antibody (NBP1-82036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LCORL Antibody Products

Related Products by Gene

Bioinformatics Tool for LCORL Antibody (NBP1-82036)

Discover related pathways, diseases and genes to LCORL Antibody (NBP1-82036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LCORL Antibody (NBP1-82036)

Discover more about diseases related to LCORL Antibody (NBP1-82036).

Blogs on LCORL

There are no specific blogs for LCORL, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our LCORL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LCORL

Customers Who Bought This Also Bought