LCORL Antibody

Images

 
Immunohistochemistry: LCORL Antibody [NBP1-82036] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

LCORL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TYLHQLTLQKMVTQFKEKNESLQYETSNPTVQLKIPQLRVSSVSKSQPDGSGLLDVMYQVSKTSSVLEGSALQKLKNILPKQNKIECSGPVTHSSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCORL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
LCORL Protein (NBP1-82036PEP)

Alternate Names for LCORL Antibody

  • FLJ30696
  • LCoR-like protein
  • ligand dependent nuclear receptor corepressor-like
  • ligand-dependent nuclear receptor corepressor-like protein
  • MLR1MBLK1-related protein
  • transcription factor MLR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83477
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00064151-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49202
Species: Hu
Applications: IHC
NBP2-21005
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-90766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB170R
Species: Hu
Applications: Flow, Neut
NBP1-88447
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85479
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31365
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32439
Species: Hu
Applications: WB
NBP2-46390
Species: Hu
Applications: WB, IHC
NBP1-82964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for LCORL Antibody (NBP1-82036) (0)

There are no publications for LCORL Antibody (NBP1-82036).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LCORL Antibody (NBP1-82036) (0)

There are no reviews for LCORL Antibody (NBP1-82036). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LCORL Antibody (NBP1-82036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LCORL Antibody Products

Related Products by Gene

Bioinformatics Tool for LCORL Antibody (NBP1-82036)

Discover related pathways, diseases and genes to LCORL Antibody (NBP1-82036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LCORL Antibody (NBP1-82036)

Discover more about diseases related to LCORL Antibody (NBP1-82036).

Blogs on LCORL

There are no specific blogs for LCORL, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol LCORL

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-82036 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought