LASS6 Antibody

Images

 
Western Blot: LASS6 Antibody [H00253782-A01] - Detection against Immunogen (33.81 KDa) .
Western Blot: LASS6 Antibody [H00253782-A01] - LASS6 polyclonal antibody (A01) Western Blot analysis of LASS6 expression in IMR-32.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LASS6 Antibody Summary

Immunogen
LASS6 (NP_982288, 62 a.a. - 131 a.a.) partial recombinant protein with GST tag. PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
Specificity
LASS6 - LAG1 longevity assurance homolog 6 (S. cerevisiae)
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CERS6
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Control
Mouse Kidney Whole Tissue Lysate (Adult Whole Normal)
Reviewed Applications
Read 1 Review rated 4
using
H00253782-A01 in the following applications:

Publications
Read Publications using
H00253782-A01 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LASS6 Antibody

  • CerS6
  • LAG1 homolog, ceramide synthase 6
  • LAG1 longevity assurance homolog 6 (S. cerevisiae)
  • LAG1 longevity assurance homolog 6
  • longevity assurance homolog 6
  • MGC129949
  • MGC129950

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28480
Species: Hu
Applications: PEP-ELISA, WB
H00029956-M01A
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00079603-M03
Species: Hu
Applications: ELISA, ICC/IF, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP1-84536
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
DFS00
Species: Hu
Applications: ELISA
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
375-TL
Species: Hu
Applications: BA
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-67460
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB500-206
Species: Hu, Mu, Rt
Applications: KD, Simple Western, WB
NBP2-45889
Species: Hu
Applications: IHC, IHC-Fr, WB
NBP2-67358
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67332
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00253782-A01
Species: Hu, Mu
Applications: WB, ELISA

Publications for LASS6 Antibody (H00253782-A01)(12)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species
Showing Publications 1 - 10 of 12. Show All 12 Publications.
Publications using H00253782-A01 Applications Species
Novgorodov SA, Riley CL, Keffler JA et al. SIRT3 Deacetylates Ceramide Synthases: Implications for Mitochondrial Dysfunction and Brain Injury. J. Biol. Chem. 2015 Nov 30 [PMID: 26620563] (WB, Mouse) WB Mouse
Schull S, Gunther SD, Brodesser S et al. Cytochrome c oxidase deficiency accelerates mitochondrial apoptosis by activating ceramide synthase 6. Cell Death Dis. 2015 Mar 12 [PMID: 25766330]
Cheng JC, Bai A, Beckham TH et al. Radiation-induced acid ceramidase confers prostate cancer resistance and tumor relapse. J Clin Invest. 2013 Sep 16 [PMID: 24091326]
Hoeferlin LA, Fekry B, Ogretmen B et al. Folate Stress Induces Apoptosis via p53-Dependent de novo Ceramide Synthesis and Up-Regulation of Ceramide Synthase 6 J Biol Chem 2013 Mar 21 [PMID: 23519469] (WB, Human) WB Human
Separovic D, Breen P, Joseph N et al. siRNA-Mediated Down-regulation of Ceramide Synthase 1 Leads to Apoptotic Resistance in Human Head and Neck Squamous Carcinoma Cells after Photodynamic Therapy Anticancer Res 2012 Jul [PMID: 22753704]
Separovic D, Breen P, Joseph N et al. Ceramide synthase 6 knockdown suppresses apoptosis after photodynamic therapy in human head and neck squamous carcinoma cells. Anticancer Res. 2012 Mar 01 [PMID: 22399588]
Senkal CE, Ponnusamy S, Manevich Y et al. Alteration of Ceramide Synthase 6/C16-Ceramide Induces Activating Transcription Factor 6-mediated Endoplasmic Reticulum (ER) Stress and Apoptosis via Perturbation of Cellular Ca2+ and ER/Golgi Membrane Network. J Biol Chem. 2011 Oct 19 [PMID: 22013072]
Siskind LJ, Mullen TD, Romero Rosales K et al. The BCL-2 protein BAK is required for long-chain ceramide generation during apoptosis. J Biol Chem 285(16):11818-26. 2010 Apr 16. [PMID: 20172858]
Senkal CE, Ponnusamy S, Bielawski J et al. Antiapoptotic roles of ceramide-synthase-6-generated C16-ceramide via selective regulation of the ATF6/CHOP arm of ER-stress-response pathways. FASEB J. 2009 Sep 1. [PMID: 19723703]
White-Gilbertson S, Mullen T, Senkal C et al. Ceramide synthase 6 modulates TRAIL sensitivity and nuclear translocation of active caspase-3 in colon cancer cells. Oncogene. 2009 Feb 26 [PMID: 19137010]
Show All 12 Publications.

Review for LASS6 Antibody (H00253782-A01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00253782-A01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
  4
reviewed by:
Verified Customer
WB Human 09/30/2009
View

Summary

ApplicationWestern Blot
Sample Testedhuman cell line total lysate, Sample Amount: 50 ug
SpeciesHuman
Lot08099wecz
CommentsData is published : Senkal CE, Ponnusamy S, Bielawski J, Hannun YA, Ogretmen B.

Blocking

Blocking DetailsBlocking Buffer: 5% milk, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1/1000, Incubation Dilution Buffer: 5 % milk, Incubation Time: overnight, Incubation Temp: 4 C

Secondary Antibody

Secondary DescriptionSecondary Ab: jackson immuno Goat anti mouse HRP (conjugated)

Details

Detection NotesMethod: ECL, Exposure Time: .25-2min, Pos.Ctrl: Scr siRNA transfected cells, Neg.Ctrl: LASS6 siRNA transfected cells, Band: 42kD

Comments

CommentsData is published : Senkal CE, Ponnusamy S, Bielawski J, Hannun YA, Ogretmen B.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LASS6 Antibody (H00253782-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LASS6 Products

Bioinformatics Tool for LASS6 Antibody (H00253782-A01)

Discover related pathways, diseases and genes to LASS6 Antibody (H00253782-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LASS6 Antibody (H00253782-A01)

Discover more about diseases related to LASS6 Antibody (H00253782-A01).
 

Pathways for LASS6 Antibody (H00253782-A01)

View related products by pathway.

PTMs for LASS6 Antibody (H00253782-A01)

Learn more about PTMs related to LASS6 Antibody (H00253782-A01).

Blogs on LASS6

There are no specific blogs for LASS6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

 
Verified Customer
09/30/2009
Application: WB
Species: Human

Bioinformatics

Gene Symbol CERS6
Entrez
Uniprot