LASS6 Antibody - Azide and BSA Free

Western Blot: LASS6 Antibody [H00253782-A01] - Detection against Immunogen (33.81 KDa) .

Western Blot: LASS6 Antibody [H00253782-A01] - LASS6 polyclonal antibody (A01) Western Blot analysis of LASS6 expression in IMR-32.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LASS6 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse LASS6 Antibody - Azide and BSA Free (H00253782-A01) is a polyclonal antibody validated for use in WB and ELISA. Anti-LASS6 Antibody: Cited in 13 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: LASS6 (NP_982288, 62 a.a. - 131 a.a.) partial recombinant protein with GST tag. PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
• Specificity: LASS6 - LAG1 longevity assurance homolog 6 (S. cerevisiae)
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CERS6
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
• Control:

  Mouse Kidney Whole Tissue Lysate (Adult Whole Normal)

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50% Glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LASS6 Antibody - Azide and BSA Free

• CerS6
• LAG1 homolog, ceramide synthase 6
• LAG1 longevity assurance homolog 6 (S. cerevisiae)
• LAG1 longevity assurance homolog 6
• longevity assurance homolog 6
• MGC129949
• MGC129950

Background

LASS6 may be involved in sphingolipid synthesis or its regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LASS6 Antibody (H00253782-A01)(13)

Publications using H00253782-A01

• Pauline M, Julia Z, Mark H et al. High levels of modified ceramides are a defining feature of murine and human cancer cachexia. J Cachexia Sarcopenia Muscle. 2020-10-08 [PMID: 33090732]
• Novgorodov SA, Riley CL, Keffler JA et al. SIRT3 Deacetylates Ceramide Synthases: Implications for Mitochondrial Dysfunction and Brain Injury. J. Biol. Chem. 2015-11-30 [PMID: 26620563] (WB, Mouse)
• Schull S, Gunther SD, Brodesser S et al. Cytochrome c oxidase deficiency accelerates mitochondrial apoptosis by activating ceramide synthase 6. Cell Death Dis. 2015-03-12 [PMID: 25766330]
• Cheng JC, Bai A, Beckham TH et al. Radiation-induced acid ceramidase confers prostate cancer resistance and tumor relapse. J Clin Invest. 2013-09-16 [PMID: 24091326]
• Hoeferlin LA, Fekry B, Ogretmen B et al. Folate Stress Induces Apoptosis via p53-Dependent de novo Ceramide Synthesis and Up-Regulation of Ceramide Synthase 6 J Biol Chem 2013-03-21 [PMID: 23519469] (WB, Human)
• Separovic D, Breen P, Joseph N et al. siRNA-Mediated Down-regulation of Ceramide Synthase 1 Leads to Apoptotic Resistance in Human Head and Neck Squamous Carcinoma Cells after Photodynamic Therapy. Anticancer Res 2012-07-01 [PMID: 22753704]
• Separovic D, Breen P, Joseph N et al. Ceramide synthase 6 knockdown suppresses apoptosis after photodynamic therapy in human head and neck squamous carcinoma cells. Anticancer Res 2012-03-01 [PMID: 22399588]
• Senkal CE, Ponnusamy S, Manevich Y et al. Alteration of Ceramide Synthase 6/C16-Ceramide Induces Activating Transcription Factor 6-mediated Endoplasmic Reticulum (ER) Stress and Apoptosis via Perturbation of Cellular Ca2+ and ER/Golgi Membrane Network. J Biol Chem. 2011-10-19 [PMID: 22013072]
• Siskind LJ, Mullen TD, Romero Rosales K et al. The BCL-2 protein BAK is required for long-chain ceramide generation during apoptosis. J Biol Chem 285(16):11818-26. 2010-04-16 [PMID: 20172858]
• Senkal CE, Ponnusamy S, Bielawski J et al. Antiapoptotic roles of ceramide-synthase-6-generated C16-ceramide via selective regulation of the ATF6/CHOP arm of ER-stress-response pathways. FASEB J 2009-09-01 [PMID: 19723703]
• White-Gilbertson S, Mullen T, Senkal C et al. Ceramide synthase 6 modulates TRAIL sensitivity and nuclear translocation of active caspase-3 in colon cancer cells. Oncogene. 2009-02-26 [PMID: 19137010]
• Yu J, Novgorodov SA, Chudakova D et al. JNK3 signaling pathway activates ceramide synthase leading to mitochondrial dysfunction. J Biol Chem;282(35):25940-9. 2007-08-31 [PMID: 17609208]
• Senkal CE, Ponnusamy S, Rossi MJ et al. Role of human longevity assurance gene 1 and C18-ceramide in chemotherapy-induced cell death in human head and neck squamous cell carcinomas. Mol Cancer Ther 2007-02-01 [PMID: 17308067]

Review for LASS6 Antibody (H00253782-A01) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 09/30/2009

Summary

• Application: Western Blot
• Sample Tested: human cell line total lysate, Sample Amount: 50 ug
• Species: Human
• Lot: 08099wecz

Bioinformatics

• Gene Symbol: CERS6
• Entrez:
  • 253782(Human)
• Uniprot:
  • NP_982288(Human)