LASS1 Antibody - BSA Free

Immunohistochemistry-Paraffin: LASS1 Antibody [NBP1-92067] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Analysis in human cerebral cortex and liver tissues using NBP1-92067 antibody. Corresponding CERS1 RNA-seq data are presented for the same tissues.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LASS1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LASS1 Antibody - BSA Free (NBP1-92067) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CERS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LASS1 Protein (NBP1-92067PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LASS1 Antibody - BSA Free

• CerS1
• LAG1 homolog, ceramide synthase 1
• LAG1 longevity assurance homolog 1
• LAG1MGC90349
• longevity assurance (LAG1, S. cerevisiae) homolog 1
• Longevity assurance gene 1 protein homolog 1
• Protein UOG-1
• UOG1LAG1 longevity assurance homolog 1 (S. cerevisiae)
• upstream of GDF1

Background

LASS1 encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site that is cleaved to produce a mature protein containing seven conserved cysteine residues. Members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in yeast suggest that the encoded protein is involved in aging. This protein is transcribed from a monocistronic mRNA as well as a bicistronic mRNA, which also encodes growth differentiation factor 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CERS1