LASS4 Antibody (7D5)

Images

 
Western Blot: LASS4 Antibody (7D5) [H00079603-M03] - Analysis of LASS4 expression in HeLa (Cat # L013V1).
Immunocytochemistry/ Immunofluorescence: LASS4 Antibody (7D5) [H00079603-M03] - Analysis of monoclonal antibody to LASS4 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: LASS4 Antibody (7D5) [H00079603-M03] - Analysis of LASS4 expression in transfected 293T cell line by LASS4 monoclonal antibody (M03), clone 7D5. Lane 1: LASS4 transfected lysatE (46.4 KDa). Lane 2: ...read more
ELISA: LASS4 Antibody (7D5) [H00079603-M03] - Detection limit for recombinant GST tagged LASS4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
7D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LASS4 Antibody (7D5) Summary

Immunogen
LASS4 (NP_078828, 57 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWR
Specificity
LASS4 - LAG1 longevity assurance homolog 4 (S. cerevisiae)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CERS4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LASS4 Antibody (7D5)

  • CerS4
  • FLJ12089
  • LAG1 homolog, ceramide synthase 4
  • LAG1 longevity assurance homolog 4 (S. cerevisiae)
  • LAG1 longevity assurance homolog 4
  • Trh1

Background

LASS4 may be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed incells is involved in the production of sphingolipids containingdifferent fatty acid donnors (N-linked stearoyl- (C18)or arachidoyl- (C20) ceramides)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00253782-M01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
H00029956-M01A
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-28480
Species: Hu
Applications: PEP-ELISA, WB
NBP2-94348
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-76964
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-74045
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
H00008877-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00007357-M03
Species: Hu
Applications: ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
355-BM
Species: Hu, Mu, Rt
Applications: BA
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-52567
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-91353
Species: Hu, Mu
Applications: WB

Publications for LASS4 Antibody (H00079603-M03) (0)

There are no publications for LASS4 Antibody (H00079603-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LASS4 Antibody (H00079603-M03) (0)

There are no reviews for LASS4 Antibody (H00079603-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LASS4 Antibody (H00079603-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LASS4 Antibody (7D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CERS4
Entrez
Uniprot