Langerin/CD207 Antibody - BSA Free

Western Blot: Langerin/CD207 Antibody [NBP1-84448] - Analysis in control (vector only transfected HEK293T lysate) and CD207 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Langerin/CD207 Antibody [NBP1-84448] - Staining in human skin and pancreas tissues using NBP1-84448 antibody. Corresponding CD207 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Langerin/CD207 Antibody [NBP1-84448] - Staining of human colon shows strong cytoplasmic positivity in a subset of lymphoid cells.

Immunohistochemistry-Paraffin: Langerin/CD207 Antibody [NBP1-84448] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Langerin/CD207 Antibody [NBP1-84448] - Staining of human skin shows strong cytoplasmic positivity in Langerhans cells.

Immunohistochemistry-Paraffin: Langerin/CD207 Antibody [NBP1-84448] - Staining of human tonsil shows strong cytoplasmic positivity in a subset of non-germinal center cells.

Analysis in control (vector only transfected HEK293T lysate) and cD207 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402461).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Langerin/CD207 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Langerin/CD207 Antibody - BSA Free (NBP1-84448) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD207
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Langerin/CD207 Protein (NBP1-84448PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Langerin/CD207 Antibody - BSA Free

• CD207 antigen
• CD207 antigen, langerin
• CD207 molecule, langerin
• CD207
• CLEC4KLangerhans cell specific c-type lectin
• C-type lectin domain family 4 member K
• C-type lectin domain family 4, member K
• Langerin

Background

Langerin (CD207) is a type II membrane-associated C-type lectin known to be expressed exclusively by Langerhans cells. Langerin recognizes mannose residues via its single carbohydrate recognition domain (CRD). Langerin is localized not only on the cell surface, but also intracellularly in close association with Birbeck granules. Transfection of Langerin cDNA into fibroblasts creates a compact network of membrane structures with typical features of Birbeck granules (BG). Langerin is thus a potent inducer of membrane superimposition and zippering leading to BG formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD207