Langerin/CD207 Antibody

Images

 
Western Blot: Langerin/CD207 Antibody [NBP1-84448] - Analysis in control (vector only transfected HEK293T lysate) and cD207 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Langerin/CD207 Antibody [NBP1-84448] - Staining of human skin shows distinct cytoplasmic positivity in a subset of cells that resembled Langerhans cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Langerin/CD207 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD207
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Langerin/CD207 Protein (NBP1-84448PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Langerin/CD207 Antibody

  • CD207 antigen
  • CD207 antigen, langerin
  • CD207 molecule, langerin
  • CD207
  • CLEC4KLangerhans cell specific c-type lectin
  • C-type lectin domain family 4 member K
  • C-type lectin domain family 4, member K
  • Langerin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-46123
Species: Hu
Applications: WB, IHC, IHC-P, IF
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
MAB161
Species: Hu
Applications: WB, Flow, IHC, AdBlk, CyTOF-ready, ICC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NBP2-15199
Species: Hu, Eq
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB1774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Langerin/CD207 Antibody (NBP1-84448) (0)

There are no publications for Langerin/CD207 Antibody (NBP1-84448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Langerin/CD207 Antibody (NBP1-84448) (0)

There are no reviews for Langerin/CD207 Antibody (NBP1-84448). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Langerin/CD207 Antibody (NBP1-84448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Langerin/CD207 Products

Bioinformatics Tool for Langerin/CD207 Antibody (NBP1-84448)

Discover related pathways, diseases and genes to Langerin/CD207 Antibody (NBP1-84448). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Langerin/CD207 Antibody (NBP1-84448)

Discover more about diseases related to Langerin/CD207 Antibody (NBP1-84448).
 

Pathways for Langerin/CD207 Antibody (NBP1-84448)

View related products by pathway.

PTMs for Langerin/CD207 Antibody (NBP1-84448)

Learn more about PTMs related to Langerin/CD207 Antibody (NBP1-84448).

Blogs on Langerin/CD207

There are no specific blogs for Langerin/CD207, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Langerin/CD207 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD207
Entrez