Langerin/CD207 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Langerin/CD207 Antibody - BSA Free (NBP1-84448) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CD207 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Langerin/CD207 Antibody - BSA Free
Background
Langerin (CD207) is a type II membrane-associated C-type lectin known to be expressed exclusively by Langerhans cells. Langerin recognizes mannose residues via its single carbohydrate recognition domain (CRD). Langerin is localized not only on the cell surface, but also intracellularly in close association with Birbeck granules. Transfection of Langerin cDNA into fibroblasts creates a compact network of membrane structures with typical features of Birbeck granules (BG). Langerin is thus a potent inducer of membrane superimposition and zippering leading to BG formation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: Flow, IF, IHC, IHC-Fr
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Ca, Fe, Hu, Mu, Sh
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: WB, IHC
Publications for Langerin/CD207 Antibody (NBP1-84448) (0)
There are no publications for Langerin/CD207 Antibody (NBP1-84448).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Langerin/CD207 Antibody (NBP1-84448) (0)
There are no reviews for Langerin/CD207 Antibody (NBP1-84448).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Langerin/CD207 Antibody (NBP1-84448) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Langerin/CD207 Products
Research Areas for Langerin/CD207 Antibody (NBP1-84448)
Find related products by research area.
|
Blogs on Langerin/CD207