Laminin gamma 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining in human placenta and tonsil tissues using anti-LAMC1 antibody. Corresponding LAMC1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human cerebral cortex, kidney, placenta and tonsil using Anti-LAMC1 antibody NBP1-87718 (A) shows similar protein distribution across tissues to independent antibody NBP1-87719 (B).

Western Blot: Laminin gamma 1 Antibody [NBP1-87718] - Analysis in human cell line CACO-2 and human cell line PC-3.

Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human tonsil using Anti-LAMC1 antibody NBP1-87718.

Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human placenta shows high expression.

Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human tonsil shows low expression as expected.

Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human kidney.

Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human placenta using Anti-LAMC1 antibody NBP1-87718.

Simple Western: Laminin gamma 1 Antibody [NBP1-87718] - Simple Western lane view shows a specific band for LAMC1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.

Simple Western: Laminin gamma 1 Antibody [NBP1-87718] - Electropherogram image(s) of corresponding Simple Western lane view. Laminin gamma 1 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Laminin gamma 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Laminin gamma 1 Antibody - BSA Free (NBP1-87718) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-Laminin gamma 1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LAMC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Simple Western 1:20
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 267, 264 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  Laminin gamma 1 Protein (NBP1-87718PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%), Mouse (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Laminin gamma 1 Antibody - BSA Free

• LAMB2Laminin-7 subunit gamma
• LAMC1
• Laminin B2 chain
• Laminin B2
• Laminin gamma 1
• laminin subunit gamma-1
• laminin, gamma 1 (formerly LAMB2)
• Laminin-1 subunit gamma
• Laminin-10 subunit gamma
• Laminin-11 subunit gamma
• Laminin-2 subunit gamma
• Laminin-3 subunit gamma
• Laminin-4 subunit gamma
• Laminin-6 subunit gamma
• Laminin-8 subunit gamma
• Laminin-9 subunit gamma
• MGC87297
• S-LAM gamma
• S-laminin subunit gamma

Background

Laminins are essential and abundant structural non-collagenous glycoproteins localizing to basement membranes. Basement membranes (cell-associated extracellular matrices (ECMs)) are polymers of Laminins with stabilizing Type IV Collagen networks, Nidogen and several proteoglycans. Basement membranes are found under epithelial layers, around the endothelium of blood vessels, and surrounding muscle, peripheral nerve and fat cells. Formation of basement membranes influences cell proliferation, phenotype, migration, gene expression and tissue architecture. Each Laminin is a heterotrimer of alpha, beta and gamma chain subunits that undergoes cell-secretion and incorporation into the ECM. Laminins can self-assemble, bind to other matrix macromolecules and have unique and shared cell interactions mediated by Integrins, dystroglycan and cognate Laminin receptors. The human Laminin gamma-1 gene maps to chromosome 1q31 and is ubiquitously expressed in tissues that produce basement membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Laminin gamma 1 Antibody (NBP1-87718)(1)

Publication using NBP1-87718

• Kuhn E, Kurman RJ, Soslow R et al. The diagnostic and biological implications of laminin expression in serous tubal intraepithelial carcinoma. Am J Surg Pathol 2012-12-01 [PMID: 22892598]

Bioinformatics

• Gene Symbol: LAMC1