LAD1 Antibody

Images

 
Western Blot: LAD1 Antibody [NBP1-85945] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-310
Immunocytochemistry/ Immunofluorescence: LAD1 Antibody [NBP1-85945] - Staining of human cell line A-431 shows positivity in cytoskeleton (actin filaments).
Immunohistochemistry-Paraffin: LAD1 Antibody [NBP1-85945] - Staining of human gall bladder shows strong luminal membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LAD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEGRNSLSPVQATQKPLVSKKELEIPPRRRLSREQRGPWALEEESLVGREPEERKKGVPEKSPVLEKSSMPKKTAPEKSLVSDKTSISEKVLASEKTSLSEKIAVSEKRNSSEKKSVLEKTSVSEKSLAP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LAD1 Protein (NBP1-85945PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LAD1 Antibody

  • LAD
  • lad-1
  • LadA
  • ladinin 1
  • ladinin-1
  • linear IgA bullous dermatosis antigen
  • linear IgA disease antigen homolog
  • Linear IgA disease antigen
  • MGC10355

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15135
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00003033-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-85892
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LAD1 Antibody (NBP1-85945) (0)

There are no publications for LAD1 Antibody (NBP1-85945).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAD1 Antibody (NBP1-85945) (0)

There are no reviews for LAD1 Antibody (NBP1-85945). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LAD1 Antibody (NBP1-85945) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LAD1 Products

LAD1 NBP1-85945

Bioinformatics Tool for LAD1 Antibody (NBP1-85945)

Discover related pathways, diseases and genes to LAD1 Antibody (NBP1-85945). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAD1 Antibody (NBP1-85945)

Discover more about diseases related to LAD1 Antibody (NBP1-85945).
 

Pathways for LAD1 Antibody (NBP1-85945)

View related products by pathway.

PTMs for LAD1 Antibody (NBP1-85945)

Learn more about PTMs related to LAD1 Antibody (NBP1-85945).

Blogs on LAD1

There are no specific blogs for LAD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAD1