Lactate Dehydrogenase B Recombinant Protein Antigen

Images

 
There are currently no images for Lactate Dehydrogenase B Protein (NBP2-38131PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Lactate Dehydrogenase B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LDHB.

Source: E. coli

Amino Acid Sequence: HPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LDHB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38131.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP2-38131PEP.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lactate Dehydrogenase B Recombinant Protein Antigen

  • EC 1.1.1
  • EC 1.1.1.27
  • Epididymis Secretory Protein Li 281
  • HEL-S-281
  • Lactate Dehydrogenase B
  • LDH heart subunit
  • LDHB
  • LDH-B
  • LDHBD
  • LDH-H
  • L-lactate dehydrogenase B chain
  • Renal Carcinoma Antigen NY-REN-46
  • TRG-5

Background

Lactate dehydrogenase (LDH) is an ubiquitous enzyme commonly found in wide variety of organisms, including plants and microbes. LDH is involved in the interconversion of the pyruvate and NADH to lactate and NAD+. It is also called Hydroxybutyrate Dehydrogenase (HBD), because it can catalyze the oxidation of hydroxybutyrate (1). In mammals, three types of LDH subunits (35 kDa) are encoded by the genes Ldh-A, Ldh-B, and Ldh-C. All LDH subunits can combine to form various terameric isoenzymes (140 kDa). Lactate dehydrogenase B (LDH-B, heart subunit, LDH-H) is involved in the conversion of L-lactate and NAD to pryruvate and NADH and it is predominantly localized in the heart tissue. Similar to other LDH subunit, LDH-B is considered to be an important marker for germ cell tumor (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48336
Species: Bv, Hu, Mu, Po
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-68160
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31589
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00002023-M01
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-32259
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-02043
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-03621
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005236-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
NBP2-38131PEP
Species: Hu
Applications: AC

Publications for Lactate Dehydrogenase B Protein (NBP2-38131PEP)(2)

Reviews for Lactate Dehydrogenase B Protein (NBP2-38131PEP) (0)

There are no reviews for Lactate Dehydrogenase B Protein (NBP2-38131PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lactate Dehydrogenase B Protein (NBP2-38131PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lactate Dehydrogenase B Products

Research Areas for Lactate Dehydrogenase B Protein (NBP2-38131PEP)

Find related products by research area.

Blogs on Lactate Dehydrogenase B

There are no specific blogs for Lactate Dehydrogenase B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lactate Dehydrogenase B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LDHB