Lactate Dehydrogenase A/LDHA Antibody

Images

 
Western Blot: Lactate Dehydrogenase A/LDHA Antibody [H00003939-B01P] - Analysis of LDHA expression in human liver.
Immunocytochemistry/ Immunofluorescence: Lactate Dehydrogenase A/LDHA Antibody [H00003939-B01P] - Analysis of purified antibody to LDHA on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Lactate Dehydrogenase A/LDHA Antibody [H00003939-B01P] - Analysis of LDHA expression in transfected 293T cell line by LDHA polyclonal antibody. Lane 1: LDHA transfected lysate(36.52 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Lactate Dehydrogenase A/LDHA Antibody Summary

Immunogen
LDHA (NP_005557.1, 1 a.a. - 332 a.a.) full-length human protein. MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
LDHA
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lactate Dehydrogenase A/LDHA Antibody

  • Cell proliferation-inducing gene 19 protein
  • EC 1.1.1
  • EC 1.1.1.27
  • GSD11
  • Lactate Dehydrogenase A
  • lactate dehydrogenase M
  • LDH muscle subunit
  • LDH1
  • LDHA
  • LDH-A
  • LDHM
  • LDH-M
  • L-lactate dehydrogenase A chain
  • proliferation-inducing gene 19
  • Renal carcinoma antigen NY-REN-59

Background

Lactate dehydrogenase (LDH) is an ubiquitous enzyme commonly found in wide variety of organisms, including plants and microbes. LDH is involved in the interconversion of the pyruvate and NADH to lactate and NAD+. It is also called Hydroxybutyrate Dehydrogenase (HBD), due to the fact that it can catalyze the oxidation of hydroxybutyrate (1). In mammals, three types of LDH subunits (35 kDa) are encoded by the genes Ldh-A, Ldh-B, and Ldh-C, forming various terameric isoenzymes (140 kDa). Lactate dehydrogenase A (LDH-A, muscle subunit, LDH-M) is involved in the final step of anaerobic glycoysis and catalyzes the conversion of L-lactate and NAD to pryruvate and NADH. While it is predominantly expressed in muscle tissue, it is hormonally regulated in rodents and overexpressed during mammary gland tumorigenesis (2). A mutation that cause deficiency in LDH-A has been implicated in exertional myoglobinuria (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53421
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
H00003939-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for Lactate Dehydrogenase A/LDHA Antibody (H00003939-B01P) (0)

There are no publications for Lactate Dehydrogenase A/LDHA Antibody (H00003939-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lactate Dehydrogenase A/LDHA Antibody (H00003939-B01P) (0)

There are no reviews for Lactate Dehydrogenase A/LDHA Antibody (H00003939-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Lactate Dehydrogenase A/LDHA Antibody (H00003939-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lactate Dehydrogenase A/LDHA Products

Bioinformatics Tool for Lactate Dehydrogenase A/LDHA Antibody (H00003939-B01P)

Discover related pathways, diseases and genes to Lactate Dehydrogenase A/LDHA Antibody (H00003939-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lactate Dehydrogenase A/LDHA Antibody (H00003939-B01P)

Discover more about diseases related to Lactate Dehydrogenase A/LDHA Antibody (H00003939-B01P).
 

Pathways for Lactate Dehydrogenase A/LDHA Antibody (H00003939-B01P)

View related products by pathway.

PTMs for Lactate Dehydrogenase A/LDHA Antibody (H00003939-B01P)

Learn more about PTMs related to Lactate Dehydrogenase A/LDHA Antibody (H00003939-B01P).

Blogs on Lactate Dehydrogenase A/LDHA

There are no specific blogs for Lactate Dehydrogenase A/LDHA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lactate Dehydrogenase A/LDHA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LDHA
Entrez
Uniprot