![Western Blot: KY Antibody [NBP1-93859] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/KY-Antibody-Western-Blot-NBP1-93859-img0004.jpg "Western Blot: KY Antibody [NBP1-93859] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AQGTLSDQQANPSSLLQRGGGFQGVGNGVRRWQKLEGNDFHENLVEKQHPQQPQVITSYNSQGTQLTVEVHPRDAMPQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KY |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Western-Blot-NB300-560-img0004.jpg)
-Immunohistochemistry-Frozen-NB300-560-img0009.jpg)
-Immunohistochemistry-Paraffin-NB300-560-img0010.jpg)
-Flow-Cytometry-NB110-68136-img0011.jpg)
-Immunocytochemistry-Immunofluorescence-NB110-68136-img0012.jpg)
-Flow-Cytometry-NB110-68136-img0013.jpg)
![Simple Western CLEC3B/Tetranectin Antibody (805035) [Unconjugated]](https://images.novusbio.com/images2/CLEC3B_MAB5170_Simple_Western_17560.jpg)
![Western Blot CLEC3B/Tetranectin Antibody (805035) [Unconjugated]](https://images.novusbio.com/images2/CLEC3B_MAB5170_Western_Blot_12710.jpg)
-Western-Blot-NBP2-46290-img0020.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-46290-img0021.jpg)
-Immunohistochemistry-Paraffin-NBP2-46290-img0022.jpg)
-Western-Blot-NBP2-36776-img0015.jpg)
-Immunohistochemistry-NBP2-36776-img0001.jpg)
-Immunohistochemistry-NBP2-36776-img0002.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for KY Antibody (NBP1-93859)Discover more about diseases related to KY Antibody (NBP1-93859).
| Pathways for KY Antibody (NBP1-93859)View related products by pathway.
|
PTMs for KY Antibody (NBP1-93859)Learn more about PTMs related to KY Antibody (NBP1-93859).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KY |
![Immunocytochemistry/Immunofluorescence: KY Antibody [NBP1-93859] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/KY-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93859-img0005.jpg "Immunocytochemistry/Immunofluorescence: KY Antibody [NBP1-93859] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: KY Antibody [NBP1-93859] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/KY-Antibody-Immunohistochemistry-Paraffin-NBP1-93859-img0002.jpg "Immunohistochemistry-Paraffin: KY Antibody [NBP1-93859] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry Glycophorin A Antibody (R10) [Unconjugated]](https://images.novusbio.com/images2/Glycophorin_A_MAB1228_Immunohistochemistry_19187.jpg)
![Flow Cytometry Glycophorin A Antibody (R10) [Unconjugated]](https://images.novusbio.com/images2/Glycophorin_A_MAB1228_Flow_Cytometry_19288.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_CF_720.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_CF_722.jpg)
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")