KY Antibody

Images

 
Western Blot: KY Antibody [NBP1-93859] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: KY Antibody [NBP1-93859] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: KY Antibody [NBP1-93859] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KY Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AQGTLSDQQANPSSLLQRGGGFQGVGNGVRRWQKLEGNDFHENLVEKQHPQQPQVITSYNSQGTQLTVEVHPRDAMPQ
Specificity
Specificity of human KY antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KY Antibody

  • kyphoscoliosis peptidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005555-P01
Species: Hu
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-04611
Species: Hu
NBP2-38190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-75442
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF6387
Species: Hu
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KY Antibody (NBP1-93859) (0)

There are no publications for KY Antibody (NBP1-93859).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KY Antibody (NBP1-93859) (0)

There are no reviews for KY Antibody (NBP1-93859). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KY Antibody (NBP1-93859) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KY Products

Bioinformatics Tool for KY Antibody (NBP1-93859)

Discover related pathways, diseases and genes to KY Antibody (NBP1-93859). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KY Antibody (NBP1-93859)

Discover more about diseases related to KY Antibody (NBP1-93859).
 

Pathways for KY Antibody (NBP1-93859)

View related products by pathway.

PTMs for KY Antibody (NBP1-93859)

Learn more about PTMs related to KY Antibody (NBP1-93859).

Blogs on KY

There are no specific blogs for KY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KY Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KY