WHIP Antibody - BSA Free

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human cerebral cortex, liver, placenta and prostate using Anti-WRNIP1 antibody NBP2-38190 (A) shows similar protein distribution across tissues to independent antibody NBP1-90030 (B).

Western Blot: WHIP Antibody [NBP2-38190] - Analysis using Anti-WRNIP1 antibody NBP2-38190 (A) shows similar pattern to independent antibody NBP1-90030 (B).

Immunocytochemistry/Immunofluorescence: WHIP Antibody [NBP2-38190] - Staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: WHIP Antibody [NBP2-38190] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

siRNA knockdown efficiency of WRNIP1 and stable expression of WT and mutant WRN and WRNIP1 proteins.(A) (i) Schematic representation of WRNIP1 protein. The positions of UBZ, siRNA target site, the core ATPase domain, and the position of K274A mutation in this domain are indicated. (ii) The sequence of the conserved Walker A motif containing the ATP-binding-deficient K577A mutation in WRN or K274A mutation in WRNIP1 is shown. (iii) Western blot analyses of the efficiency of WRNIP1 knockdown in HFs and BBMEFs. (B) Western blot analyses of stable expression of WT and mutant WRN proteins in WRN-/- HFs (left) and BBMEFs (right). (C) Western blot analyses of stable expression of WT and mutant WRNIP1 proteins in WT HFs (left) and BBMEFs (right). (D) Western blot analyses of stable expression of combinations of WRN and WRNIP1 mutant proteins in WRN-/- HFs (left) and BBMEFs (right).Figure 1—figure supplement 1—source data 1.Original uncropped images for western blots shown in Figure 1—figure supplement 1.Figure 1—figure supplement 1—source data 2.Original uncropped images for western blots shown in Figure 1—figure supplement 1 (labelled).Original uncropped images for western blots shown in Figure 1—figure supplement 1.Original uncropped images for western blots shown in Figure 1—figure supplement 1 (labelled). Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/40900148), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WHIP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CKKSGQSYSPSRVLITENDVKEGLQRSHILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFAS
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WRNIP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  WHIP Protein (NBP2-38190PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WHIP Antibody - BSA Free

• ATPase WRNIP1
• bA420G6.2
• EC 3.6.1
• FLJ22526
• putative helicase RUVBL
• Werner helicase interacting protein 1
• Werner helicase-interacting protein 1
• WHIPRP11-420G6.2

Background

Werner's syndrome is a rare autosomal recessive disorder characterized by premature aging. The protein encoded by this gene interacts with the N-terminal portion of Werner protein containing the exonuclease domain. This protein shows homology to replication factor C family proteins, and is conserved from E. coli to human. Studies in yeast suggest that this gene may influence the aging process. Two transcript variants encoding different isoforms have been isolated for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WHIP Antibody (NBP2-38190)(1)

Publication using NBP2-38190

• Yoon J, Sellamuthu K, Prakash L et al. WRN and WRNIP1 ATPases impose high fidelity on translesion synthesis by Y-family DNA polymerases eLife 2025-09-03 [PMID: 40900148]

Bioinformatics

• Gene Symbol: WRNIP1
• Uniprot:
  • Q96S55(Human)