Klotho Antibody

Images

 
Western Blot: Klotho Antibody [NBP1-55097] - Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Klotho Antibody Summary

Immunogen
Synthetic peptides corresponding to KL(klotho) The peptide sequence was selected from the n terminal of KL (BAA24941). Peptide sequence FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP.
Specificity
Recognizes Klotho isoform 2 (62 kDa band observed).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against KL and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-55097.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Klotho Antibody

  • EC 3.2.1
  • EC 3.2.1.31
  • KL
  • Klotho

Background

This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production of this protein has been observed in patients with chronic renal failure (CRF), and this may be one of the factors underlying the degenerative processes (

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P

Publications for Klotho Antibody (NBP1-55097)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-55097 Applications Species
Chen,D. J. Biol. Chem. 282 (46), 33776-33787. 2007 [PMID: 17893151]

Reviews for Klotho Antibody (NBP1-55097) (0)

There are no reviews for Klotho Antibody (NBP1-55097). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Klotho Antibody (NBP1-55097). (Showing 1 - 1 of 1 FAQ).

  1. I study physiology (PhD) and I need a klotho kit.
    • A list of our klotho products can be found here. I am not entirely sure what you are looking for as I don't have your complete message for some reason. Can you please clarify what you are looking for?

Secondary Antibodies

 

Isotype Controls

Additional Klotho Products

Bioinformatics Tool for Klotho Antibody (NBP1-55097)

Discover related pathways, diseases and genes to Klotho Antibody (NBP1-55097). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Klotho Antibody (NBP1-55097)

Discover more about diseases related to Klotho Antibody (NBP1-55097).
 

Pathways for Klotho Antibody (NBP1-55097)

View related products by pathway.

PTMs for Klotho Antibody (NBP1-55097)

Learn more about PTMs related to Klotho Antibody (NBP1-55097).

Blogs on Klotho

There are no specific blogs for Klotho, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Klotho Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KL
Entrez
Uniprot