KLF8 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human KLF8 (NP_009181.2). GKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KLF8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Western Blot 1:500-1:2000
|
| Theoretical MW |
39 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for KLF8 Antibody - Azide and BSA Free
Background
The KLF8 gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in t
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: ICC, ICFlow
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for KLF8 Antibody (NBP3-04846) (0)
There are no publications for KLF8 Antibody (NBP3-04846).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KLF8 Antibody (NBP3-04846) (0)
There are no reviews for KLF8 Antibody (NBP3-04846).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KLF8 Antibody (NBP3-04846) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KLF8 Products
Blogs on KLF8