KLF3 Antibody


Western Blot: KLF3 Antibody [NBP2-48937] - Analysis in human cell line K562.
Immunocytochemistry/ Immunofluorescence: KLF3 Antibody [NBP2-48937] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human colorectal cancer shows strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: KLF3 Antibody [NBP2-48937] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

KLF3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SYEKPISQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKR
Predicted Species
Mouse (96%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KLF3 Recombinant Protein Antigen (NBP2-48937PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KLF3 Antibody

  • Basic krueppel-like factor
  • basic Kruppel-like factor
  • BKLFbasic kruppel like factor
  • CACCC-box-binding protein BKLF
  • Krueppel-like factor 3
  • Kruppel-like factor 3 (basic)
  • MGC48279
  • TEF-2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, IP, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm
Applications: WB
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ChIP, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for KLF3 Antibody (NBP2-48937) (0)

There are no publications for KLF3 Antibody (NBP2-48937).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF3 Antibody (NBP2-48937) (0)

There are no reviews for KLF3 Antibody (NBP2-48937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KLF3 Antibody (NBP2-48937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KLF3 Products

Array NBP2-48937

Bioinformatics Tool for KLF3 Antibody (NBP2-48937)

Discover related pathways, diseases and genes to KLF3 Antibody (NBP2-48937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF3 Antibody (NBP2-48937)

Discover more about diseases related to KLF3 Antibody (NBP2-48937).

Pathways for KLF3 Antibody (NBP2-48937)

View related products by pathway.

PTMs for KLF3 Antibody (NBP2-48937)

Learn more about PTMs related to KLF3 Antibody (NBP2-48937).

Research Areas for KLF3 Antibody (NBP2-48937)

Find related products by research area.

Blogs on KLF3

There are no specific blogs for KLF3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KLF3 Antibody and receive a gift card or discount.


Gene Symbol KLF3