KF1 Antibody

Images

 
Immunohistochemistry-Paraffin: KF1 Antibody [NBP2-31700] - Staining of human colon shows strong cytoplasmic positivity in endothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF103
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KF1 Protein (NBP2-31700PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KF1 Antibody

  • E3 ubiquitin-protein ligase RNF103
  • EC 6.3.2.-
  • hkf-1
  • KF-1
  • KF1ZFP103ZFP-103
  • MGC102815
  • ring finger protein 103MGC41857
  • Zfp-103
  • zinc finger protein 103 homolog (mouse)
  • Zinc finger protein 103 homolog
  • zinc finger protein expressed in cerebellum

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-82845
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00004068-M01
Species: Hu
Applications: WB, ELISA
NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NB100-56357
Species: Hu
Applications: WB, IP
NBP1-81711
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt

Publications for KF1 Antibody (NBP2-31700) (0)

There are no publications for KF1 Antibody (NBP2-31700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KF1 Antibody (NBP2-31700) (0)

There are no reviews for KF1 Antibody (NBP2-31700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KF1 Antibody (NBP2-31700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KF1 Products

Bioinformatics Tool for KF1 Antibody (NBP2-31700)

Discover related pathways, diseases and genes to KF1 Antibody (NBP2-31700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KF1 Antibody (NBP2-31700)

Discover more about diseases related to KF1 Antibody (NBP2-31700).
 

Pathways for KF1 Antibody (NBP2-31700)

View related products by pathway.

PTMs for KF1 Antibody (NBP2-31700)

Learn more about PTMs related to KF1 Antibody (NBP2-31700).
 

Research Areas for KF1 Antibody (NBP2-31700)

Find related products by research area.

Blogs on KF1

There are no specific blogs for KF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF103
Uniprot