Rapsyn Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Rapsyn Antibody [NBP1-85537] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Rapsyn Antibody [NBP1-85537] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rapsyn Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE
Specificity
Specificity of human Rapsyn antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAPSN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID: 30543681).
Control Peptide
Rapsyn Protein (NBP1-85537PEP)
Publications
Read Publications using
NBP1-85537 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rapsyn Antibody

  • 43 kDa postsynaptic protein
  • Acetylcholine receptor-associated 43 kDa protein
  • CMS1D43 kDa receptor-associated protein of the synapse
  • CMS1EMGC3597
  • rapsyn
  • receptor-associated protein of the synapse
  • receptor-associated protein of the synapse, 43kD
  • RNF205RING finger protein 205

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1519
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14868
Species: Hu, Mu, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-81070
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, B/N
AF562
Species: Rt
Applications: WB, Neut
NBP1-30052
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
NB120-2804
Species: Hu, Mu, Rt, Am, Ch, Fi
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-61674
Species: Hu
Applications: WB, ELISA
NBP1-79952
Species: Hu
Applications: WB
NB100-93304
Species: Hu
Applications: WB, IP
NBP1-20900
Species: Hu
Applications: WB, PEP-ELISA
NBP1-85537
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Rapsyn Antibody (NBP1-85537)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-85537 Applications Species
Juhlen R, Breckpot J, Fahrenkrog B Centrosome and ciliary abnormalities in fetal akinesia deformation sequence human fibroblasts bioRxiv (ICC/IF) ICC/IF
Bonnin E, Cabochette P, Filosa A et al. Biallelic mutations in nucleoporin NUP88 cause lethal fetal akinesia deformation sequence PLoS Genet. [PMID: 30543681] (WB, IHC, Human) WB, IHC Human

Reviews for Rapsyn Antibody (NBP1-85537) (0)

There are no reviews for Rapsyn Antibody (NBP1-85537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Rapsyn Antibody (NBP1-85537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Rapsyn Products

Bioinformatics Tool for Rapsyn Antibody (NBP1-85537)

Discover related pathways, diseases and genes to Rapsyn Antibody (NBP1-85537). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rapsyn Antibody (NBP1-85537)

Discover more about diseases related to Rapsyn Antibody (NBP1-85537).
 

Pathways for Rapsyn Antibody (NBP1-85537)

View related products by pathway.

Research Areas for Rapsyn Antibody (NBP1-85537)

Find related products by research area.

Blogs on Rapsyn

There are no specific blogs for Rapsyn, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rapsyn Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAPSN