Rapsyn Antibody

Images

 
Western Blot: Rapsyn Antibody [NBP1-85537] - (A) HeLa and (B) C2C12 cells were treated with the indicated siRNAs for 2 days and cellular lysates were subjected to Western blot analysis using Rapsyn antibody. GAPDH was ...read more
Immunocytochemistry/ Immunofluorescence: Rapsyn Antibody [NBP1-85537] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Rapsyn Antibody [NBP1-85537] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rapsyn Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAPSN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature (PMID: 30543681).
Control Peptide
Rapsyn Protein (NBP1-85537PEP)
Publications
Read Publications using
NBP1-85537 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rapsyn Antibody

  • 43 kDa postsynaptic protein
  • Acetylcholine receptor-associated 43 kDa protein
  • CMS1D43 kDa receptor-associated protein of the synapse
  • CMS1EMGC3597
  • rapsyn
  • receptor-associated protein of the synapse
  • receptor-associated protein of the synapse, 43kD
  • RNF205RING finger protein 205

Background

Rapsyn belongs to a family of proteins that are receptor associated proteins of the synapse. It contains a conserved cAMP-dependent protein kinase phosphorylation site. It is believed to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin. Two splice variants have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

550-AG/CF
Species: Rt
Applications: BA, BA
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6868
Species: Hu
Applications: IHC, KO, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-81070
Species: Hu, Mu, Rt
Applications: B/N, ELISA, ICC/IF, WB
AF562
Species: Rt
Applications: Neut, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
NB120-2804
Species: Am, Ch, Fi, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-61674
Species: Hu
Applications: ELISA, WB
NBP1-79952
Species: Hu
Applications: WB
NB100-93304
Species: ChHa, Hu
Applications: IP, WB
NBP2-19540
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85537
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Rapsyn Antibody (NBP1-85537)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 3 of 3.
Publications using NBP1-85537 Applications Species
Bonnin E, Cabochette P, Filosa A et al. Biallelic mutations in nucleoporin NUP88 cause lethal fetal akinesia deformation sequence PLoS Genet. [PMID: 30543681] (IHC, WB, Human) IHC, WB Human
Juhlen R, Breckpot J, Fahrenkrog B Centrosome and ciliary abnormalities in fetal akinesia deformation sequence human fibroblasts bioRxiv (ICC/IF) ICC/IF
Juhlen R, Breckpot J, Fahrenkrog B Centrosome and ciliary abnormalities in fetal akinesia deformation sequence human fibroblasts Sci Rep 2020-11-10 [PMID: 33168876]

Reviews for Rapsyn Antibody (NBP1-85537) (0)

There are no reviews for Rapsyn Antibody (NBP1-85537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Rapsyn Antibody (NBP1-85537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rapsyn Products

Bioinformatics Tool for Rapsyn Antibody (NBP1-85537)

Discover related pathways, diseases and genes to Rapsyn Antibody (NBP1-85537). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rapsyn Antibody (NBP1-85537)

Discover more about diseases related to Rapsyn Antibody (NBP1-85537).
 

Pathways for Rapsyn Antibody (NBP1-85537)

View related products by pathway.

Research Areas for Rapsyn Antibody (NBP1-85537)

Find related products by research area.

Blogs on Rapsyn

There are no specific blogs for Rapsyn, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rapsyn Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAPSN