KERA Antibody


Immunohistochemistry-Paraffin: KERA Antibody [NBP1-84425] - Staining of human gallbladder shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P

Order Details

KERA Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYL
Specificity of human, mouse KERA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KERA Protein (NBP1-84425PEP)
Read Publication using
NBP1-84425 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25713466).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KERA Antibody

  • CNA2
  • keratocan
  • KTN
  • SLRR2BKeratan sulfate proteoglycan keratocan


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KERA Antibody (NBP1-84425)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for KERA Antibody (NBP1-84425) (0)

There are no reviews for KERA Antibody (NBP1-84425). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KERA Antibody (NBP1-84425) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for KERA Antibody (NBP1-84425)

Discover related pathways, diseases and genes to KERA Antibody (NBP1-84425). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KERA Antibody (NBP1-84425)

Discover more about diseases related to KERA Antibody (NBP1-84425).

Pathways for KERA Antibody (NBP1-84425)

View related products by pathway.

PTMs for KERA Antibody (NBP1-84425)

Learn more about PTMs related to KERA Antibody (NBP1-84425).

Blogs on KERA

There are no specific blogs for KERA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KERA Antibody and receive a gift card or discount.


Gene Symbol KERA