KERA Antibody - BSA Free

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KERA Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KERA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KERA Protein (NBP1-84425PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25713466).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KERA Antibody - BSA Free

• CNA2
• KERA
• Keratocan
• KTN
• SLRR2B
• SLRR2BKeratan sulfate proteoglycan keratocan

Background

KERA is a gene that codes for a protein that helps develop and maintain corneal transparency, as it is highly expressed in the cornea, as well as contributes to the structure of the stromal matrix that has a length of 352 amino acids and a weight of approximately 40.5 kDa. Studies are being conducted on severeal diseases and disorders relating to this gene, including cornea plana congenital, acrus senilis, keratopathy, corneal dystrophy, hyperopia, and glaucoma. KERA has also been shown to have interactions with CXCL2, B3GNT7, CHST1, CHST5, and CHST6 in pathways such as the MAroteaux-Lamy syndrome, metabolic, and Sanfilippo syndrome pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KERA Antibody (NBP1-84425)(2)

Publications using NBP1-84425

• Blanco-Elices C, Morales-�lvarez C, Chato-Astrain J et al. Development of stromal differentiation patterns in heterotypical models of artificial corneas generated by tissue engineering Frontiers in Bioengineering and Biotechnology 2023-03-23 [PMID: 37034263] (Immunohistochemistry, Mouse)
• Syed-Picard FN, Du Y, Lathrop KL et al. Dental Pulp Stem Cells: A New Cellular Resource for Corneal Stromal Regeneration. Stem Cells Transl Med 2015-03-01 [PMID: 25713466] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: KERA