KAT3B/p300 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody [NBP1-87693] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: KAT3B/p300 Antibody [NBP1-87693] -Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: KAT3B/p300 Antibody [NBP1-87693] -Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.

Immunohistochemistry-Paraffin: KAT3B/p300 Antibody [NBP1-87693] -Staining of human duodenum shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: KAT3B/p300 Antibody [NBP1-87693] -Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KAT3B/p300 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KAT3B/p300 Antibody - BSA Free (NBP1-87693) is a polyclonal antibody validated for use in IHC, ELISA and ICC/IF. Anti-KAT3B/p300 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQ
• Predicted Species: Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EP300
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KAT3B/p300 Protein (NBP1-87693PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KAT3B/p300 Antibody - BSA Free

• E1A binding protein p300
• E1A-associated protein p300
• E1A-binding protein, 300kD
• EC 2.3.1
• EC 2.3.1.48
• EP300
• histone acetyltransferase p300
• KAT3B
• p300 HAT
• p300
• RSTS2

Background

p300 is a relatively stable and ubiquitously expressed nuclear phosphoprotein which is conserved among a variety of mammalian species. It is actively synthesized and phosphorylated in both quiescent and proliferating cells. Cyclic AMP-responsive enhancer binding protein (CREB) binding protein (CBP) and p300 are closely related transcriptional coactivators and have been shown to directly interact with many different DNA-binding transcription factors including nuclear hormone receptors, CREB, c-Fos, C-Jun/v-Jun, c-Myb/v-Myb, TFIIB and MyoD. Both CBP and p300 have been shown to display histone acetyltransferase (HAT) activity, capable of acetylating all four core histone particles in nucleosomes. As a result of HAT activity, it has been suggested CBP and p300 may play a direct role in activating chromatin for transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KAT3B/p300 Antibody (NBP1-87693)(1)

Publication using NBP1-87693

• Marwarha G, Slagsvold KH, Høydal MA NF-?B Transcriptional Activity Indispensably Mediates Hypoxia-Reoxygenation Stress-Induced microRNA-210 Expression International journal of molecular sciences 2023-04-01 [PMID: 37047592] (ELISA)

Bioinformatics

• Gene Symbol: EP300