Kallikrein 4/Prostase/EMSP1 Antibody

Immunohistochemistry-Paraffin: Kallikrein 4/Prostase/EMSP1 Antibody [NBP2-14171] - Staining in human prostate and endometrium tissues using anti-KLK4 antibody. Corresponding KLK4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Kallikrein 4/Prostase/EMSP1 Antibody [NBP2-14171] - Staining of human prostate shows high expression.

Immunohistochemistry-Paraffin: Kallikrein 4/Prostase/EMSP1 Antibody [NBP2-14171] - Staining of human endometrium shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Kallikrein 4/Prostase/EMSP1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: TIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLK4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Kallikrein 4/Prostase/EMSP1 Protein (NBP2-14171PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Kallikrein 4/Prostase/EMSP1 Antibody

• AI2A1
• ARM1
• EC 3.4.21
• EC 3.4.21.-
• EMSP
• EMSP1
• EMSP1MGC116827
• Enamel matrix serine proteinase 1
• kallikrein 4 (prostase, enamel matrix, prostate)
• Kallikrein 4
• kallikrein-4
• Kallikrein-like protein 1
• kallikrein-related peptidase 4
• KLK4
• KLK-L1MGC116828
• Prostase
• PRSS17enamel matrix serine protease 1
• PSTSandrogen-regulated message 1
• Serine protease 17

Background

Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. The novel KLK gene, KLK-L4, is expressed in a variety of tissues including prostate, salivary gland, breast, and testis. Its expression is regulated by steroid hormones in breast cancer cell lines may be involved in the pathogenesis and/or progression of breast cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLK4