Kallikrein 4/Prostase/EMSP1 Antibody


Immunohistochemistry-Paraffin: Kallikrein 4/Prostase/EMSP1 Antibody [NBP2-14171] - Staining of human prostate shows high expression.
Immunohistochemistry-Paraffin: Kallikrein 4/Prostase/EMSP1 Antibody [NBP2-14171] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Kallikrein 4/Prostase/EMSP1 Antibody [NBP2-14171] - Staining in human prostate and endometrium tissues using anti-KLK4 antibody. Corresponding KLK4 RNA-seq data are presented for the same ...read more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Kallikrein 4/Prostase/EMSP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSK LYDPLYH
Specificity of human Kallikrein 4/Prostase/EMSP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kallikrein 4/Prostase/EMSP1 Protein (NBP2-14171PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Kallikrein 4/Prostase/EMSP1 Antibody

  • AI2A1
  • ARM1
  • EC 3.4.21
  • EC 3.4.21.-
  • EMSP
  • EMSP1
  • EMSP1MGC116827
  • Enamel matrix serine proteinase 1
  • kallikrein 4 (prostase, enamel matrix, prostate)
  • Kallikrein 4
  • kallikrein-4
  • Kallikrein-like protein 1
  • kallikrein-related peptidase 4
  • KLK4
  • KLK-L1MGC116828
  • Prostase
  • PRSS17enamel matrix serine protease 1
  • PSTSandrogen-regulated message 1
  • Serine protease 17


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Ba
Applications: WB, ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, IP, Neut
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB

Publications for Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171) (0)

There are no publications for Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171) (0)

There are no reviews for Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Kallikrein 4/Prostase/EMSP1 Products

Bioinformatics Tool for Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171)

Discover related pathways, diseases and genes to Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171)

Discover more about diseases related to Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171).

Pathways for Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171)

View related products by pathway.

PTMs for Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171)

Learn more about PTMs related to Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171).

Research Areas for Kallikrein 4/Prostase/EMSP1 Antibody (NBP2-14171)

Find related products by research area.

Blogs on Kallikrein 4/Prostase/EMSP1

There are no specific blogs for Kallikrein 4/Prostase/EMSP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kallikrein 4/Prostase/EMSP1 Antibody and receive a gift card or discount.


Gene Symbol KLK4