KA2/GRIK5/Glutamate Receptor KA2 Antibody

Images

 
Western Blot: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270] - Jurkat cell lysate. Suggested Antibody Titration: 0.2 - 1 ug/mL.
Immunocytochemistry/ Immunofluorescence: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270] - FFPE Human Pineal Tissue. Primary antibody at 1:100.
Immunocytochemistry/ Immunofluorescence: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270] - Mouse Retina, 25 ug/mL.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KA2/GRIK5/Glutamate Receptor KA2 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human GRIK5. Peptide sequence EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRIK5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against GRIK5 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KA2/GRIK5/Glutamate Receptor KA2 Antibody

  • EAA2
  • Excitatory amino acid receptor 2
  • GluK5
  • glutamate receptor KA2
  • Glutamate receptor KA-2
  • glutamate receptor, ionotropic kainate 5
  • glutamate receptor, ionotropic, kainate 5
  • GRIK2
  • GRIK5
  • KA2/GRIK5
  • KA2GRIK2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76851
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP1-76849
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-89765
Species: Hu
Applications: IHC, IHC-P
NB300-124
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-67737
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-61782
Species: Hu
Applications: ELISA, ICC/IF, WB
NB300-118
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NLS921
Species: Bv, Hu
Applications: ICC, IHC, IHC-P, WB
NBP1-02312
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP3-03558
Species: Hu, Mu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, PAGE, WB
NBP1-88790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-106
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NLS3208
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC, IHC-P, WB
NB300-105
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-76932
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-81567
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-126
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
H00000761-M02
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
NBP1-48272
Species: Hu, Pm, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
NB300-107
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB

Publications for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP1-80270) (0)

There are no publications for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP1-80270).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP1-80270) (0)

There are no reviews for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP1-80270). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP1-80270) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KA2/GRIK5/Glutamate Receptor KA2 Products

Bioinformatics Tool for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP1-80270)

Discover related pathways, diseases and genes to KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP1-80270). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP1-80270)

Discover more about diseases related to KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP1-80270).
 

Pathways for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP1-80270)

View related products by pathway.

Blogs on KA2/GRIK5/Glutamate Receptor KA2

There are no specific blogs for KA2/GRIK5/Glutamate Receptor KA2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KA2/GRIK5/Glutamate Receptor KA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIK5
Uniprot