ITM2B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ITM2B Antibody [NBP2-57975] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ITM2B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRA
Specificity
Specificity of human ITM2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITM2B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
ITM2B Knockout HeLa Cell Lysate
Control Peptide
ITM2B Recombinant Protein Antigen (NBP2-57975PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ITM2B Antibody

  • ABRI
  • ABri/ADan amyloid peptide
  • BRI
  • BRI2
  • BRICD2B
  • BRICHOS domain containing 2B
  • BRIFBD
  • E25B
  • E3-16
  • FBD
  • integral membrane protein 2B
  • ITM2B
  • Protein E25B
  • Transmembrane protein BRI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, B/N
AF4904
Species: Hu
Applications: WB
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-66907
Species: Hu, Mu, Rt, Fi, Ze
Applications: WB, IHC, IHC-P
NBP2-47559
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59510
Species: Hu
Applications: WB, IHC, IHC-P
AF4876
Species: Hu
Applications: WB
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87512
Species: Hu
Applications: IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western

Publications for ITM2B Antibody (NBP2-57975) (0)

There are no publications for ITM2B Antibody (NBP2-57975).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITM2B Antibody (NBP2-57975) (0)

There are no reviews for ITM2B Antibody (NBP2-57975). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ITM2B Antibody (NBP2-57975) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ITM2B Products

Bioinformatics Tool for ITM2B Antibody (NBP2-57975)

Discover related pathways, diseases and genes to ITM2B Antibody (NBP2-57975). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITM2B Antibody (NBP2-57975)

Discover more about diseases related to ITM2B Antibody (NBP2-57975).
 

Pathways for ITM2B Antibody (NBP2-57975)

View related products by pathway.

PTMs for ITM2B Antibody (NBP2-57975)

Learn more about PTMs related to ITM2B Antibody (NBP2-57975).
 

Research Areas for ITM2B Antibody (NBP2-57975)

Find related products by research area.

Blogs on ITM2B

There are no specific blogs for ITM2B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITM2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITM2B