Signal peptide peptidase-like 2B Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Signal peptide peptidase-like 2B Antibody - BSA Free (NBP2-55073) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YWAGSRDVKKRYMKHKRDDGPEKQEDEAVDV |
| Predicted Species |
Mouse (97%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SPPL2B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Signal peptide peptidase-like 2B Antibody - BSA Free
Background
The Signal peptide peptidase-like 2B gene encodes a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins withtwo conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes,lysosomes, and the pla
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA, IHC, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Publications for Signal peptide peptidase-like 2B Antibody (NBP2-55073) (0)
There are no publications for Signal peptide peptidase-like 2B Antibody (NBP2-55073).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Signal peptide peptidase-like 2B Antibody (NBP2-55073) (0)
There are no reviews for Signal peptide peptidase-like 2B Antibody (NBP2-55073).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Signal peptide peptidase-like 2B Antibody (NBP2-55073) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Signal peptide peptidase-like 2B Products
Blogs on Signal peptide peptidase-like 2B