IRAK3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

IRAK3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IRAK3.
  
  

  Source: E. coli

  Amino Acid Sequence: SWLDVRHIEKYVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIPEHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: IRAK3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83094.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IRAK3 Recombinant Protein Antigen

• ASRT5
• EC 2.7.11.1
• FLJ13601
• IL-1 receptor-associated kinase M
• interleukin-1 receptor-associated kinase 3
• IRAK3
• IRAK-3
• IRAKM
• IRAK-M

Background

IRAK3 is a novel member in the IRAK/Pelle family. IRAKs associate with IL-1/Toll receptors after IL-1 or LPS stimulation and play a central role in IL-1R/TLR mediated inflammatory responses. Interleukin-1 (IL-1) and lipopolysaccharide (LPS)induces cellular response through IL-1 receptor (IL-1R) and Toll like receptors (TLR). IL-1 receptor associated kinase (IRAK and IRAK2) mediates the activation of NF-kB by IL-1/Toll receptors (Wesche H et al.1999,Muzio M et al.1997), which is a pivotal transcription factor mediating inflammatory and immune response. A novel member in theIRAK/Pelle family was recently identified and designated IRAK-M (Cao Z et al.1996). IRAKs associate with IL-1/Toll receptors after IL-1 or LPS stimulation and thedominant negative mutants of IRAKs inhibit IL-1 orLPS induced NF-kB activation. Members inIRAK/Pelle family play a central role in IL-1R/TLRmediated inflammatory responses to cytokine IL-1and LPS.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: IRAK3