Integrin beta 4/CD104 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: IVDTVLMAPRSAKPALLKLTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPAGTATLGRRLVNITIIKEQAR |
| Predicted Species |
Mouse (91%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ITGB4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Integrin beta 4/CD104 Antibody - BSA Free
Background
Integrin beta 4 is a glycoprotein which associates with the a6 integrin to form the a6/b4 complex. Integrin alpha 6/beta 4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Defects in Integrin beta 4 gene are a cause of epidermolysis bullosa letalis with pyloric atresia (EB PA); also known as junctional epidermolysis bullosa with pyloric atresia (PA-JEB) or aplasia cutis congenita with gastrointestinal atresia. EB-PA is characterized by mucocutaneous fragility and gastrointestinal atresia, which most commonly affects the pylorus. Moreover, defects in Integrin beta 4 gene are a cause of generalized atrophic benign epidermolysis bullosa (GABEB). This nonlethal form of junctional epidermolysis bullosa is characterized by life long blistering of the skin, associated with hair and tooth abnormalities.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, WB
Publications for Integrin beta 4/CD104 Antibody (NBP2-38298) (0)
There are no publications for Integrin beta 4/CD104 Antibody (NBP2-38298).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Integrin beta 4/CD104 Antibody (NBP2-38298) (0)
There are no reviews for Integrin beta 4/CD104 Antibody (NBP2-38298).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Integrin beta 4/CD104 Antibody (NBP2-38298) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Integrin beta 4/CD104 Products
Research Areas for Integrin beta 4/CD104 Antibody (NBP2-38298)
Find related products by research area.
|
Blogs on Integrin beta 4/CD104