| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIR |
| Specificity | Specificity of human TRNT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRNT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Theoretical MW | 50 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-86589 | Applications | Species |
|---|---|---|
| Akiyama Y, Lyons SM, Fay MM et al. Multiple ribonuclease A family members cleave transfer RNAs in response to stress bioRxiv 2019 Oct 21 (KD, WB, Human) | KD, WB | Human |
| Yip, MCJ;Keszei, AFA;Feng, Q;Chu, V;McKenna, MJ;Shao, S; Mechanism for recycling tRNAs on stalled ribosomes Nat. Struct. Mol. Biol. Apr 22 2019 [PMID: 31011209] (WB, Human) | WB | Human |
| DeLuca AP, Whitmore SS, Barnes J et al. Hypomorphic mutations in TRNT1 cause retinitis pigmentosa with erythrocytic microcytosis. Hum Mol Genet 2016 Jan 01 [PMID: 26494905] (WB) | WB | |
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013 Apr [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
Diseases for TRNT1 Antibody (NBP1-86589)Discover more about diseases related to TRNT1 Antibody (NBP1-86589).
| Pathways for TRNT1 Antibody (NBP1-86589)View related products by pathway.
|

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.