Home » TRNT1 » TRNT1 Antibodies » TRNT1 Antibody

TRNT1 Antibody

 (5 Publications)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: TRNT1 Antibody [NBP1-86589] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TRNT1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Genetic Strategies: Western Blot: TRNT1 Antibody [NBP1-86589] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TRNT1 antibody. Remaining relative intensity is ...read more
Immunocytochemistry/ Immunofluorescence: TRNT1 Antibody [NBP1-86589] - Staining of human cell line A-431 shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TRNT1 Antibody [NBP1-86589] - Staining of human stomach shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western Blot: TRNT1 Antibody [NBP1-86589] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

TRNT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIR
Specificity
Specificity of human TRNT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRNT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Simple Western 1:8
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
TRNT1 Protein (NBP1-86589PEP)
Publications
Read Publications using
NBP1-86589 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRNT1 Antibody

  • CCA1
  • CCA-adding
  • CGI-47
  • EC 2.7.7.72
  • mitochondrial CCA-adding tRNA-nucleotidyltransferase
  • mt CCA-adding enzyme
  • mt tRNA adenylyltransferase
  • mt tRNA CCA-diphosphorylase
  • mt tRNA CCA-pyrophosphorylase
  • MtCCA
  • tRNA nucleotidyl transferase, CCA-adding, 1
  • tRNA-nucleotidyltransferase 1, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(16 Publications)
Species: Hu
G protein alpha
inhibitor 1 Antibody ...
H00002770-M01
Western Blot: G protein alpha inhibitor 1 Antibody (2B8-2A5) [H00002770-M01] - Analysis of GNAI1 expression in transfected 293T cell line by GNAI1 monoclonal antibody (M01), clone 2B8-2A5.Lane 1: GNAI1 transfected lysate(40.4 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: G protein alpha inhibitor 1 Antibody (2B8-2A5) [H00002770-M01] - Analysis of monoclonal antibody to GNAI1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Western Blot: G protein alpha inhibitor 1 Antibody (2B8-2A5) [H00002770-M01] - GNAI1 monoclonal antibody (M01), clone 2B8-2A5. Analysis of GNAI1 expression in human liver.
(1 Publication)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NPDC-1 Antibody
AF5489
Western blot shows lysates of human brain tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human NPDC‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5489) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for NPDC‑1 at approximately 40 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
NPDC‑1 was detected in immersion fixed paraffin-embedded sections of human brain (hippocampus) using Sheep Anti-Human NPDC‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5489) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies and synaptic vesicles of neuronal processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
integrin beta 4
binding protein Antib ...
NBP2-13954
Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human skeletal muscle shows low expression as expected.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Comparative proteome analysis of 3xTg-AD and control samples at different stages of AD. Immunoblot analysis of most regulated hits. Soluble fractions of brain proteins were analyzed from four 2-month-old control and 3xTg-AD mice animals, respectively. Hebp1 and Glo1 levels were consistently elevated in the transgenic animals as compared to wild type controls. Ca1 levels were reduced in transgenic animals. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/47498), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.
Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human cell line HELA.
(3 Publications)
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Nectin-1/PVRL1
Antibody
AF2880
Nectin-1/PVRL1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: WB
PRR7 Antibody
(TRAP3/10)
NBP1-30424
Western Blot: PRR7 Antibody (TRAP3/10) [NBP1-30424] - Detection of PRR7 / TRAP3 in murine brain lysate by Western blotting using the monoclonal antibody TRAP3/10.
Immunocytochemistry/Immunofluorescence: PRR7 Antibody (TRAP3/10) [NBP1-30424] - Staining of HEK-293 cells cotransfected with PRR7 / TRAP3 (red) and GFP-PSD-95 (green). PRR7 / TRAP3 detected by monoclonal antibody TRAP3/10. DNA visualized by DAPI (blue).
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
PRR9 Antibody
NBP1-91041
Immunohistochemistry-Paraffin: PRR9 Antibody [NBP1-91041] - Staining of human hair follicle shows strong cytoplasmic and nuclear positivity in internal root sheath and hair cortex.
Immunohistochemistry-Paraffin: PRR9 Antibody [NBP1-91041] - Staining of human placenta shows strong nuclear positivity in decidua cells.
Species: Hu
Applications: IHC, IHC-P
ELF3/ESE-1 Antibody
NBP1-30873
Western Blot: ELF3/ESE-1 Antibody [NBP1-30873] - Loss of Elf3 preserves the mesenchymal state. Immunoblot showing ELF3 and E-cadherin protein levels in response to Elf3 silencing by siRNAs. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2073-4409/8/8/858) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: ELF3/ESE-1 Antibody [NBP1-30873] - Methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: ELF3/ESE-1 Antibody [NBP1-30873] - Paraffin-embedded human lung carcinoma. ESE1 antibody [C2C3], C-term diluted at 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
PRR5 Antibody
AF5309
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, Jurkat human acute T cell leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human PRR5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5309) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for PRR5 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Species: Hu
Applications: WB
c-Myb Antibody
NBP1-80306
Western Blot: c-Myb Antibody [NBP1-80306] - WB Suggested Anti-MYB Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate
Immunohistochemistry-Paraffin: c-Myb Antibody [NBP1-80306] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: c-Myb Antibody [NBP1-80306] - c-Myb in MOLT-4 cells transfected with siRNA. Image from verified customer review.
(1 Review)
(2 Publications)
Species: Hu, Av
Applications: WB, ICC/IF, IHC, IHC-P, KD
PGAP3 Antibody
21670002
ELISA: PGAP3 Antibody [21670002]
(2 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
CACNB2 Antibody
(6C4)
H00000783-M05
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in NIH/3T3 (Cat # L018V1).
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - analysis of CACNB2 in HEK293 and CHO whole cell lysates using anti-CACNB2 antibody. Image from verified customer review.
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in Hela S3 NE (Cat # L013V3).
(2 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: WB, ELISA, S-ELISA
Elf4/MEF Antibody
NBP2-33286
Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining in human stomach and cerebral cortex tissues using anti-ELF4 antibody. Corresponding ELF4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining of human stomach shows high expression.
Species: Hu
Applications: IHC, IHC-P
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB, IP, DirELISA
SLC25A1 Antibody
NBP1-31851
Western Blot: SLC25A1 Antibody [NBP1-31851] - Whole cell extract (30 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with SLC25A1 antibody [N1C1] diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: SLC25A1 Antibody [NBP1-31851] - HepG2 cells were fixed in ice-cold MeOH for 5 min. Green: SLC25A1 protein stained by SLC25A1 antibody [N1C1] diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: SLC25A1 Antibody [NBP1-31851] - Rat tissue extract (30 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with SLC25A1 antibody [N1C1] diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
SMPD1 Antibody
(OTI3H7)
NBP2-45889
Western Blot: SMPD1 Antibody (3H7) [NBP2-45889] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SMPD1.
Immunohistochemistry: SMPD1 Antibody (3H7) [NBP2-45889] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: SMPD1 Antibody (3H7) [NBP2-45889] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-Fr
PRR3 Antibody
NBP2-55986
Immunocytochemistry/Immunofluorescence: PRR3 Antibody [NBP2-55986] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & cytosol.
Species: Hu
Applications: ICC/IF
Nectin-3/PVRL3
Antibody [Unconjugate
AF3064
Nectin‑3 was detected in immersion fixed paraffin-embedded sections of human kidney array using Goat Anti-Human Nectin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3064) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
TRNT1 Antibody
NBP1-86589
TRNT1 Antibody
Species: Hu, Rt, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD

Publications for TRNT1 Antibody (NBP1-86589)(5)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: KD, SDS-PAGE, WB.


Filter By Application
KD
(1)
SDS-PAGE
(1)
WB
(3)
All Applications
Filter By Species
Human
(3)
All Species

Reviews for TRNT1 Antibody (NBP1-86589) (0)

There are no reviews for TRNT1 Antibody (NBP1-86589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRNT1 Antibody (NBP1-86589). (Showing 1 - 1 of 1 FAQs).

  1. Our vial of NBP1-86589 (TRNT1 Antibody) did not list a concentration on its label or datasheet and this information is of vital importance for an experiment I am about to run. The lot number on the vial we have is R34130. Is there any way to obtain the co
    • The antibody that you are just about to use is the current Lot (R34130) with the concentration of 0.4 mg/ml.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional TRNT1 Products

Bioinformatics Tool for TRNT1 Antibody (NBP1-86589)

Discover related pathways, diseases and genes to TRNT1 Antibody (NBP1-86589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRNT1 Antibody (NBP1-86589)

Discover more about diseases related to TRNT1 Antibody (NBP1-86589).
 

Pathways for TRNT1 Antibody (NBP1-86589)

View related products by pathway.

Blogs on TRNT1

There are no specific blogs for TRNT1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRNT1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TRNT1
Entrez
Uniprot