Immunocytochemistry/ Immunofluorescence: TRNT1 Antibody [NBP1-86589] - Staining of human cell line A-431 shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TRNT1 Antibody [NBP1-86589] - Staining of human stomach shows moderate cytoplasmic and nuclear positivity in glandular cells.
Genetic Strategies: Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TRNT1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
PK11195 may boost TSPO expression but cannot restore siTRNT1-mediated reduction in inflammatory cytokine production. To examine the role of TSPO in macrophage inflammatory responses, RAW264.7 cells were transfected with ...read more
Novus Biologicals Rabbit TRNT1 Antibody - BSA Free (NBP1-86589) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-TRNT1 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIR
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRNT1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG; separated by size; antibody dilution of 1:8.
Theoretical MW
50 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
The CCA-adding enzyme TRNT1 (EC 2.7.7.25) is an essential enzyme that catalyzes the addition of the CCA terminus to the 3-prime end of tRNA precursors. This reaction is a fundamental prerequisite for mature tRNAs to become aminoacylated and to participate in protein biosynthesis (Lizano et al., 2007 (PubMed 17204286)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Akiyama Y, Lyons SM, Fay MM et al. Multiple ribonuclease A family members cleave transfer RNAs in response to stress bioRxiv 2019-10-21 (KD, WB, Human)
FAQs for TRNT1 Antibody (NBP1-86589). (Showing 1 - 1 of 1 FAQs).
Our vial of NBP1-86589 (TRNT1 Antibody) did not list a concentration on its label or datasheet and this information is of vital importance for an experiment I am about to run. The lot number on the vial we have is R34130. Is there any way to obtain the co
The antibody that you are just about to use is the current Lot (R34130) with the concentration of 0.4 mg/ml.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our TRNT1 Antibody - BSA Free and receive a gift card or discount.