TRNT1 Antibody

Images

 
Genetic Strategies: Western Blot: TRNT1 Antibody [NBP1-86589] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TRNT1 antibody. Remaining relative intensity is ...read more
Immunocytochemistry/ Immunofluorescence: TRNT1 Antibody [NBP1-86589] - Staining of human cell line A-431 shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TRNT1 Antibody [NBP1-86589] - Staining of human stomach shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western Blot: TRNT1 Antibody [NBP1-86589] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

TRNT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIR
Specificity
Specificity of human TRNT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRNT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Simple Western 1:8
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
TRNT1 Protein (NBP1-86589PEP)
Publications
Read Publications using
NBP1-86589 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRNT1 Antibody

  • CCA1
  • CCA-adding
  • CGI-47
  • EC 2.7.7.72
  • mitochondrial CCA-adding tRNA-nucleotidyltransferase
  • mt CCA-adding enzyme
  • mt tRNA adenylyltransferase
  • mt tRNA CCA-diphosphorylase
  • mt tRNA CCA-pyrophosphorylase
  • MtCCA
  • tRNA nucleotidyl transferase, CCA-adding, 1
  • tRNA-nucleotidyltransferase 1, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002770-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
AF5489
Species: Hu
Applications: WB, IHC
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88191
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF2880
Species: Hu, Mu
Applications: WB
NBP1-30424
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-91041
Species: Hu
Applications: IHC, IHC-P
NBP1-30873
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
AF5309
Species: Hu
Applications: WB
NBP1-80306
Species: Hu, Av
Applications: WB, ICC/IF, IHC, IHC-P, KD
21670002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00000783-M05
Species: Hu, Mu
Applications: WB, ELISA, S-ELISA
NBP2-33286
Species: Hu
Applications: IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-45889
Species: Hu
Applications: WB, IHC, IHC-Fr
NBP2-55986
Species: Hu
Applications: ICC/IF
AF3064
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-86589
Species: Hu, Rt, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD

Publications for TRNT1 Antibody (NBP1-86589)(5)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: KD, SDS-PAGE, WB.


Filter By Application
KD
(1)
SDS-PAGE
(1)
WB
(3)
All Applications
Filter By Species
Human
(3)
All Species

Reviews for TRNT1 Antibody (NBP1-86589) (0)

There are no reviews for TRNT1 Antibody (NBP1-86589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRNT1 Antibody (NBP1-86589). (Showing 1 - 1 of 1 FAQs).

  1. Our vial of NBP1-86589 (TRNT1 Antibody) did not list a concentration on its label or datasheet and this information is of vital importance for an experiment I am about to run. The lot number on the vial we have is R34130. Is there any way to obtain the co
    • The antibody that you are just about to use is the current Lot (R34130) with the concentration of 0.4 mg/ml.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRNT1 Products

Bioinformatics Tool for TRNT1 Antibody (NBP1-86589)

Discover related pathways, diseases and genes to TRNT1 Antibody (NBP1-86589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRNT1 Antibody (NBP1-86589)

Discover more about diseases related to TRNT1 Antibody (NBP1-86589).
 

Pathways for TRNT1 Antibody (NBP1-86589)

View related products by pathway.

Blogs on TRNT1

There are no specific blogs for TRNT1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRNT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRNT1
Entrez
Uniprot