Integrin beta 1/CD29 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: KANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEP |
| Predicted Species |
Mouse (91%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ITGB1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Integrin beta 1/CD29 Antibody - BSA Free
Background
Integrin beta-1 (ITGB1, CD29, VLA-beta) is the beta subunit found in the integrin families, forming a heterodimer integrin receptor through non-covalent bonding with various integrin alpha subunits. Integrin heterodimer containing Integrin beta-1 binds to various cell surface and extracellular proteins (CD49a-f, CD51) to mediate cell to cell and cell to matrix adhesion (1). Integrin beta-1 plays a critical role in the cell adhesion and recognition in embryogenesis, hemostasis, immune response, tissue repair, metastatic diffusion of tumor cells and development (2, 3, 4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Mu
Applications: AdBlk, IHC, WB
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: AdBlk
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IP, WB
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: BA
Publications for Integrin beta 1/CD29 Antibody (NBP2-62630) (0)
There are no publications for Integrin beta 1/CD29 Antibody (NBP2-62630).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Integrin beta 1/CD29 Antibody (NBP2-62630) (0)
There are no reviews for Integrin beta 1/CD29 Antibody (NBP2-62630).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Integrin beta 1/CD29 Antibody (NBP2-62630). (Showing 1 - 1 of 1 FAQ).
-
I'm looking for a good antibody for integrins that works in rats. I would need it for Western Blot, Immunocyto- as well as Immunohistochemistry. I'm especially interested in beta1.
- I would recommend NB110-57123 as it has been validated using rat samples in WB, IHC-P, and FACS. Although we do not list ICC on the datasheet for this antibody I believe it will work in ICC because it works in Flow Cytometry and has been validated to stain tissue. We have several other Integrin targets. To search for what you are looking for I recommend typing Integrin into the search area at the top of our website, then review the list of suggested targets that poplulate below the search. Once you click on a particular Integrin you can narrow the results with our filter. I recommend filtering to primary antibodies, by target name, species of interest you can filter to rat. If you so choose you can also filter further by application, host, clonality, etc.