Integrin alpha 5/CD49e Antibody

Images

 
Western Blot: Integrin alpha 5/CD49e Antibody [NBP1-84576] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody [NBP1-84576] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Western Blot: Integrin alpha 5/CD49e Antibody [NBP1-84576] - Analysis in human cell line U-138 MG.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin alpha 5/CD49e Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Integrin alpha 5/CD49e Protein (NBP1-84576PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-84576 in the following applications:

Publications
Read Publication using
NBP1-84576 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23640047).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha 5/CD49e Antibody

  • CD49 antigen-like family member E
  • CD49e antigen
  • CD49e
  • Fibronectin receptor subunit alpha
  • fibronectin receptor, alpha subunit
  • FNRAVLA5A
  • Integrin alpha 5
  • integrin alpha-5
  • Integrin alpha-F
  • integrin, alpha 5 (fibronectin receptor, alpha polypeptide)
  • ITGA5
  • very late activation protein 5, alpha subunit
  • VLA-5 alpha
  • VLA-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
796-IC
Species: Mu
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
BBA37
Species: Hu
Applications: AdBlk
NBP1-85747
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5676
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready

Publications for Integrin alpha 5/CD49e Antibody (NBP1-84576)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for Integrin alpha 5/CD49e Antibody (NBP1-84576) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-84576:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Integrin alpha 5/CD49e NBP1-84576
Enlarge
reviewed by:
Anonymous
WB Human 10/10/2012
View

Summary

ApplicationWestern Blot
Sample TestedMDA-MB-231 Cell Lysate
SpeciesHuman
CommentsAntibody detects a band at the intended molecular weight. Suggested dilution of 1:500 is too high at least under these conditions. I could never see expected differences according to treatments so I bought a BD ab used at 1:5000 dilution and it worked great.Not sure if it was an antibody problem or if just required some optimization.

Blocking

Blocking Details5% Milk in PBS-T, 20min, RT

Primary Anitbody

Dilution Ratio1:500 in 5% Milk in PBS-T, O/N, 4C

Secondary Antibody

Secondary Descriptiongoat anti-rabbit IgG-HRP
Secondary Concentration1:5000

Details

Detection NotesECL Prime, 10 seconds

Comments

CommentsAntibody detects a band at the intended molecular weight. Suggested dilution of 1:500 is too high at least under these conditions. I could never see expected differences according to treatments so I bought a BD ab used at 1:5000 dilution and it worked great.Not sure if it was an antibody problem or if just required some optimization.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 5/CD49e Antibody (NBP1-84576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 5/CD49e Products

Bioinformatics Tool for Integrin alpha 5/CD49e Antibody (NBP1-84576)

Discover related pathways, diseases and genes to Integrin alpha 5/CD49e Antibody (NBP1-84576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 5/CD49e Antibody (NBP1-84576)

Discover more about diseases related to Integrin alpha 5/CD49e Antibody (NBP1-84576).
 

Pathways for Integrin alpha 5/CD49e Antibody (NBP1-84576)

View related products by pathway.

PTMs for Integrin alpha 5/CD49e Antibody (NBP1-84576)

Learn more about PTMs related to Integrin alpha 5/CD49e Antibody (NBP1-84576).

Blogs on Integrin alpha 5/CD49e

There are no specific blogs for Integrin alpha 5/CD49e, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
10/10/2012
Application: WB
Species: Human

Bioinformatics

Gene Symbol ITGA5
Entrez
Uniprot