Integrin alpha 2b/CD41 Antibody - BSA Free

Staining of human kidney shows no positivity in cells in tubules as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Analysis in human bone marrow and tonsil tissues using HPA031170 antibody. Corresponding ITGA2B RNA-seq data are presented for the same tissues.

Staining of human bone marrow, kidney, liver and tonsil using Anti-ITGA2B antibody HPA031170 (A) shows similar protein distribution across tissues to independent antibody HPA031168 (B).

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Integrin alpha 2b/CD41 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITGA2B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Integrin alpha 2b/CD41 Protein (NBP1-84581PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Integrin alpha 2b/CD41 Antibody - BSA Free

• CD41 antigen
• CD41
• CD41BHPA3
• GP2B
• GP2Bintegrin alpha-IIb
• GPalpha IIb
• GPIIb
• GTA
• HPA3
• Integrin alpha 2b
• integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41)
• integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41B)
• ITGA2b
• ITGAB
• platelet fibrinogen receptor, alpha subunit
• Platelet membrane glycoprotein IIb
• platelet-specific antigen BAK

Background

Integrin alpha 2b (CD41) is a calcium-dependent, noncovalently associated heterodimer and contains a heavy chain (GPIIb alpha) and a light chain (GPIIb beta) linked by a single disulfide bond. The Integrin alpha 2B chain interacts with the Integrin beta 3 subunit/CD61 to form the platelet glycoprotein complex, gpIIb/IIIa. It is expressed on platelets and megakaryocytes. Ligands for the gpIIb/IIIa heterodimer include fibrinogen, von Willebrand factor, fibronectin, vitronectin, and thrombospondin. The gpIIb/IIIa complex is the major Integrin on platelets and is important for platelet adhesion and aggregation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Integrin alpha 2b/CD41 Antibody (NBP1-84581)(1)

Publication using NBP1-84581

• Zar� M, Campodonico J, Cosentino N et al. Plasma Exosome Profile in ST-Elevation Myocardial Infarction Patients with and without Out-of-Hospital Cardiac Arrest International Journal of Molecular Sciences 2021-07-28 [PMID: 34360827] (Western Blot)

Bioinformatics

• Gene Symbol: ITGA2B