Integrin alpha 2b/CD41 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ITGA2B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 -1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Integrin alpha 2b/CD41 Antibody - BSA Free
Background
Integrin alpha 2b (CD41) is a calcium-dependent, noncovalently associated heterodimer and contains a heavy chain (GPIIb alpha) and a light chain (GPIIb beta) linked by a single disulfide bond. The Integrin alpha 2B chain interacts with the Integrin beta 3 subunit/CD61 to form the platelet glycoprotein complex, gpIIb/IIIa. It is expressed on platelets and megakaryocytes. Ligands for the gpIIb/IIIa heterodimer include fibrinogen, von Willebrand factor, fibronectin, vitronectin, and thrombospondin. The gpIIb/IIIa complex is the major Integrin on platelets and is important for platelet adhesion and aggregation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Rt
Applications: IHC, WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, IHC-P, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC
Publications for Integrin alpha 2b/CD41 Antibody (NBP1-84579) (0)
There are no publications for Integrin alpha 2b/CD41 Antibody (NBP1-84579).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Integrin alpha 2b/CD41 Antibody (NBP1-84579) (0)
There are no reviews for Integrin alpha 2b/CD41 Antibody (NBP1-84579).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Integrin alpha 2b/CD41 Antibody (NBP1-84579) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Integrin alpha 2b/CD41 Products
Research Areas for Integrin alpha 2b/CD41 Antibody (NBP1-84579)
Find related products by research area.
|
Blogs on Integrin alpha 2b/CD41