INSL3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit INSL3 Antibody - BSA Free (NBP3-04435) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human INSL3 (NP_005534.2). MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
INSL3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:100
- Immunohistochemistry 1:50-1:100
- Immunohistochemistry-Paraffin
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for INSL3 Antibody - BSA Free
Background
Insulin-like 3 (INSL3), a member of the insulin-like hormone superfamily, is specifically expressed in Leydig cells of the fetal and postnatal testis and in theca cells of the postnatal ovary. It is synthesized as a 131-amino acid preproprotein, which contains a 24-amino acid signal peptide. The human INSL3 gene is assigned to bands p13.2-p12 of the short arm of chromosome 19 with the similar organization to that of insulin and relaxin. INSL3 induces gubernaculum development in an androgen-independent way, while androgen-mediated regression of the CSL occurs independently from Insl3. Moreover, INSL3 is a ligand for LGR8 and INSL3-LGR8 mutations are believed to be associated with human cryptorchidism.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Dr, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Publications for INSL3 Antibody (NBP3-04435) (0)
There are no publications for INSL3 Antibody (NBP3-04435).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for INSL3 Antibody (NBP3-04435) (0)
There are no reviews for INSL3 Antibody (NBP3-04435).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for INSL3 Antibody (NBP3-04435) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional INSL3 Products
Research Areas for INSL3 Antibody (NBP3-04435)
Find related products by research area.
|
Blogs on INSL3