RALGDS Antibody - Azide and BSA Free

Images

 
Western Blot: RALGDS Antibody [NBP2-93790] - Analysis of extracts of various cell lines, using RALGDS Rabbit pAb at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunocytochemistry/ Immunofluorescence: RALGDS Antibody [NBP2-93790] - Analysis of U-2 OS cells using RALGDS at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: RALGDS Antibody [NBP2-93790] - Paraffin-embedded mouse testis using RALGDS .
Immunocytochemistry/ Immunofluorescence: RALGDS Antibody [NBP2-93790] - Analysis of L929 cells using RALGDS at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: RALGDS Antibody [NBP2-93790] - Paraffin-embedded human thyroid cancer using RALGDS .
Immunohistochemistry-Paraffin: RALGDS Antibody [NBP2-93790] - Paraffin-embedded rat brain using RALGDS .

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

RALGDS Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 771-902 of human RALGDS (NP_001258705). CNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIAKGIF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RALGDS
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for RALGDS Antibody - Azide and BSA Free

  • ral guanine nucleotide dissociation stimulator
  • Ral guanine nucleotide exchange factor
  • RalGDS
  • RalGEFKIAA1308
  • RGDS
  • RGFFLJ20922

Background

Stimulates the dissociation of GDP from the Ras-related RalA and RalB GTPases which allows GTP binding and activation of the GTPases. Interacts and acts as an effector molecule for R-Ras, H-Ras, K-Ras, and Rap

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP1-82956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
2308-VN
Species: Hu
Applications: BA
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-22527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP1-81858
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-88937
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for RALGDS Antibody (NBP2-93790) (0)

There are no publications for RALGDS Antibody (NBP2-93790).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RALGDS Antibody (NBP2-93790) (0)

There are no reviews for RALGDS Antibody (NBP2-93790). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RALGDS Antibody (NBP2-93790) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RALGDS Products

Diseases for RALGDS Antibody (NBP2-93790)

Discover more about diseases related to RALGDS Antibody (NBP2-93790).
 

Pathways for RALGDS Antibody (NBP2-93790)

View related products by pathway.

PTMs for RALGDS Antibody (NBP2-93790)

Learn more about PTMs related to RALGDS Antibody (NBP2-93790).
 

Research Areas for RALGDS Antibody (NBP2-93790)

Find related products by research area.

Blogs on RALGDS

There are no specific blogs for RALGDS, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RALGDS Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol RALGDS