Relaxin R1/LGR7 Antibody (3E3)

Images

 
ELISA: Relaxin R1/LGR7 Antibody (3E3) [H00059350-M01] - Detection limit for recombinant GST tagged LGR7 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, Rt, PmSpecies Glossary
Applications WB, ELISA, Flow, Func, ICC/IF, IHC
Clone
3E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Relaxin R1/LGR7 Antibody (3E3) Summary

Immunogen
LGR7 (NP_067647, 68 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WSMQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKI
Specificity
LGR7 - leucine-rich repeat-containing G protein-coupled receptor 7
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RXFP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Flow Cytometry
  • Functional
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in Immunocytochemistry/immunofluorescence and immunohistochemistry reported in scientific literature (PMID 24036884)
Publications
Read Publications using
H00059350-M01 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 24036884).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Relaxin R1/LGR7 Antibody (3E3)

  • leucine-rich repeat-containing G protein-coupled receptor 7
  • Leucine-rich repeat-containing G-protein coupled receptor 7
  • LGR7
  • LGR7.1
  • LGR7.10
  • LGR7LGR7.2
  • MGC138347
  • MGC142177
  • Relaxin family peptide receptor 1
  • Relaxin R1
  • relaxin receptor 1
  • relaxin/insulin-like family peptide receptor 1
  • RelaxinR1
  • RXFP1
  • RXFPR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS4753
Species: Dr, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3107
Species: Hu
Applications: IHC, WB
NBP1-81223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DRL200
Species: Hu
Applications: ELISA
NBP1-86343
Species: Hu
Applications: IHC, IHC-P, WB
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
NLS2576
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow

Publications for Relaxin R1/LGR7 Antibody (H00059350-M01)(11)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 2 applications: ICC/IF, IF/IHC.


Filter By Application
ICC/IF
(1)
IF/IHC
(1)
All Applications
Filter By Species
Rat
(1)
All Species
Showing Publications 1 - 10 of 11. Show All 11 Publications.
Publications using H00059350-M01 Applications Species
Hagen N, Thomas K, Friedrich P et al. C1q/TNF-Related Proteins 1, 6 and 8 Are Involved in Corneal Epithelial Wound Closure by Targeting Relaxin Receptor RXFP1 In Vitro. Int J Mol Sci. 2023-04-06 [PMID: 37047812]
Ofira Z, Alon S, Ido F et al. The distribution of relaxin receptors in the anterior segment of primary open-angle glaucoma patients. Indian J Ophthalmol. 2020-10-15 [PMID: 32971620]
T Wilhelmi, X Xu, X Tan, MS Hulshoff, S Maamari, S Sossalla, M Zeisberg, EM Zeisberg Serelaxin alleviates cardiac fibrosis through inhibiting endothelial-to-mesenchymal transition via RXFP1 Theranostics, 2020-03-04;10(9):3905-3924. 2020-03-04 [PMID: 32226528]
Jelinic M, Leo CH, Post Uiterweer ED et al. Localization of relaxin receptors in arteries and veins, and region-specific increases in compliance and bradykinin-mediated relaxation after in vivo serelaxin treatment. FASEB J. 2013-09-13 [PMID: 24036884] (IF/IHC, ICC/IF, Rat) IF/IHC, ICC/IF Rat
Soh YM, Tiwari A, Mahendroo M et al. Relaxin regulates hyaluronan synthesis and aquaporins in the cervix of late pregnant mice. Endocrinology. 2012-10-19 [PMID: 23087172]
Ferlin A, Menegazzo M, Gianesello L et al. Effect of Relaxin on Human Sperm Functions and Fertilizing Ability. J Androl. 2011-09-08 [PMID: 21903973]
Vandevoort CA, Mtango NR, Latham KE, Stewart DR. Primate preimplantation embryo is a target for relaxin during early pregnancy. Fertil Steril. 2011-06-08 [PMID: 21645893]
Feng S, Agoulnik IU, Truong A et al. Suppression of relaxin receptor RXFP1 decreases prostate cancer growth and metastasis. Endocr Relat Cancer 17(4):1021-33. 2010-10-29 [PMID: 20861284]
Vodstrcil LA, Shynlova O, Verlander JW et al. Decreased Expression of the Rat Myometrial Relaxin Receptor (RXFP1) in Late Pregnancy Is Partially Mediated by the Presence of the Conceptus. Biol Reprod. 2010-08-04 [PMID: 20686184]
Ferlin A, Pepe A, Facciolli A et al. Relaxin stimulates osteoclast differentiation and activation. Bone. 2009-10-12 [PMID: 19833242]
Show All 11 Publications.

Reviews for Relaxin R1/LGR7 Antibody (H00059350-M01) (0)

There are no reviews for Relaxin R1/LGR7 Antibody (H00059350-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Relaxin R1/LGR7 Antibody (H00059350-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Relaxin R1/LGR7 Products

Diseases for Relaxin R1/LGR7 Antibody (H00059350-M01)

Discover more about diseases related to Relaxin R1/LGR7 Antibody (H00059350-M01).
 

Pathways for Relaxin R1/LGR7 Antibody (H00059350-M01)

View related products by pathway.

PTMs for Relaxin R1/LGR7 Antibody (H00059350-M01)

Learn more about PTMs related to Relaxin R1/LGR7 Antibody (H00059350-M01).
 

Research Areas for Relaxin R1/LGR7 Antibody (H00059350-M01)

Find related products by research area.

Blogs on Relaxin R1/LGR7

There are no specific blogs for Relaxin R1/LGR7, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Relaxin R1/LGR7 Antibody (3E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol RXFP1
Entrez
OMIM
Uniprot