RGL2 Antibody (4D10)

Images

 
Western Blot: RGL2 Antibody (4D10) [H00005863-M02] - Impact of RGL2 depletion on RalB activation at autophagosomes upon starvation. Validation of RGL2 depletions. Representative western blots for RGL2 and GAPDH from ...read more
Immunocytochemistry/ Immunofluorescence: RGL2 Antibody (4D10) [H00005863-M02] - Analysis of monoclonal antibody to RGL2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: RGL2 Antibody (4D10) [H00005863-M02] - RGL2 monoclonal antibody (M02), clone 4D10 Analysis of RGL2 expression in HeLa.
ELISA: RGL2 Antibody (4D10) [H00005863-M02] - Detection limit for recombinant GST tagged RGL2 is approximately 1ng/ml as a capture antibody.
Cellular and embryonic localisation of CL-L1.A. Immunostaining of ATDC5 cells with the golgi marker 58K and CL-L1. CL-L1 shows localisation with golgi apparatus (white arrow). B. Laminin and CL-L1 coimmunolocalisation. ...read more
TRF2 is required for IE2 localization with telomeres.U2OS cells were transduced with a lentiviral vector coding for a Dox inducible control shRNA (shCtrl) or a shRNA against TRF2 (shTRF2) and selected with puromycin +/- ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RGL2 Antibody (4D10) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
RGL2 (AAH32681, 644 a.a. ~ 743 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGV
Specificity
RGL2 - ral guanine nucleotide dissociation stimulator-like 2
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
RGL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publications using
H00005863-M02 in the following applications:

  • 2 publications
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RGL2 Antibody (4D10)

  • GDS-related protein
  • HKE1.5
  • KE1.5
  • RAB2, member RAS oncogene family-like
  • RAB2LRas-associated protein RAB2L
  • ral guanine nucleotide dissociation stimulator-like 2
  • RalGDS-like 2
  • RalGDS-like factor

Background

Probable guanine nucleotide exchange factor. Putative effector of Ras and/or Rap. Associates with the GTP-bound form of Rap 1A and H-Ras in vitro

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
H00023179-M01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-15454
Species: Hu
Applications: IHC, IHC-P, WB
H00006018-M05
Species: Hu, Mu
Applications: ELISA, S-ELISA, WB
NBP1-81223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92327
Species: Hu
Applications: IHC, IHC-P, WB
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-02031
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
H00022800-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
664-LI
Species: Hu
Applications: BA
H00005863-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RGL2 Antibody (H00005863-M02)(5)

Reviews for RGL2 Antibody (H00005863-M02) (0)

There are no reviews for RGL2 Antibody (H00005863-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RGL2 Antibody (H00005863-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGL2 Products

Diseases for RGL2 Antibody (H00005863-M02)

Discover more about diseases related to RGL2 Antibody (H00005863-M02).
 

Pathways for RGL2 Antibody (H00005863-M02)

View related products by pathway.

PTMs for RGL2 Antibody (H00005863-M02)

Learn more about PTMs related to RGL2 Antibody (H00005863-M02).
 

Research Areas for RGL2 Antibody (H00005863-M02)

Find related products by research area.

Blogs on RGL2

There are no specific blogs for RGL2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGL2 Antibody (4D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol RGL2
Entrez
OMIM
Uniprot