INSL5 Antibody

Images

 
Western Blot: INSL5 Antibody [NBP1-86343] - Analysis in control (vector only transfected HEK293T lysate) and INSL5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Orthogonal Strategies: Immunohistochemistry-Paraffin: INSL5 Antibody [NBP1-86343] - Staining in human rectum and liver tissues using anti-INSL5 antibody. Corresponding INSL5 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: INSL5 Antibody [NBP1-86343] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: INSL5 Antibody [NBP1-86343] - Staining of human rectum shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

INSL5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INSL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
INSL5 Recombinant Protein Antigen (NBP1-86343PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-86343 in the following applications:

Publications
Read Publication using NBP1-86343.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for INSL5 Antibody

  • insulin-like 5
  • Insulin-like peptide 5
  • insulin-like peptide INSL5
  • MGC126695
  • MGC126697
  • PRO182
  • UNQ156

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3107
Species: Hu
Applications: IHC, WB
H00059350-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, WB
NLS4753
Species: Dr, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6979
Species: Hu
Applications: WB
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
NBP1-80834
Species: Hu
Applications: IHC, IHC-P, WB
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NLS2576
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-86343
Species: Hu
Applications: WB, IHC, IHC-P

Publications for INSL5 Antibody (NBP1-86343)(1)

Review for INSL5 Antibody (NBP1-86343) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-86343:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot INSL5 NBP1-86343
Enlarge
5
reviewed by:
Verified Customer
Western Blot Human 11/03/2016
View

Summary

ApplicationWestern Blot
Sample TestedHela whole cell lysate
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INSL5 Antibody (NBP1-86343) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INSL5 Products

Bioinformatics Tool for INSL5 Antibody (NBP1-86343)

Discover related pathways, diseases and genes to INSL5 Antibody (NBP1-86343). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INSL5 Antibody (NBP1-86343)

Discover more about diseases related to INSL5 Antibody (NBP1-86343).
 

Pathways for INSL5 Antibody (NBP1-86343)

View related products by pathway.

PTMs for INSL5 Antibody (NBP1-86343)

Learn more about PTMs related to INSL5 Antibody (NBP1-86343).

Blogs on INSL5

There are no specific blogs for INSL5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
11/03/2016
Application: Western Blot
Species: Human

Bioinformatics

Gene Symbol INSL5