Indoleamine 2,3-dioxygenase/IDO Antibody

Images

 
Western Blot: IDO1 Antibody [NBP1-87701] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: IDO1 Antibody [NBP1-87701] - Staining of human lymph node shows strong positivity in subsets of cells outside the germinal center.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Indoleamine 2,3-dioxygenase/IDO Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IDO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Indoleamine 2,3-dioxygenase/IDO Protein (NBP1-87701PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Indoleamine 2,3-dioxygenase/IDO Antibody

  • 3dioxygenase
  • EC 1.13.11.52
  • IDO
  • IDO1
  • IDOIDO-1
  • INDO
  • INDOindole 2,3-dioxygenase
  • Indoleamine 2
  • indoleamine 2,3-dioxygenase 1
  • Indoleamine 2,3-dioxygenase
  • indoleamine-pyrrole 2,3 dioxygenase
  • Indoleamine-pyrrole 2,3-dioxygenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45995
Species: Hu
Applications: WB, IHC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-45209
Species: Hu
Applications: WB, IHC-Fr, PEP-ELISA
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-24646
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-87701
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701) (0)

There are no publications for Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701) (0)

There are no reviews for Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Indoleamine 2,3-dioxygenase/IDO Products

Bioinformatics Tool for Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701)

Discover related pathways, diseases and genes to Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701)

Discover more about diseases related to Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701).
 

Pathways for Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701)

View related products by pathway.

PTMs for Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701)

Learn more about PTMs related to Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701).
 

Research Areas for Indoleamine 2,3-dioxygenase/IDO Antibody (NBP1-87701)

Find related products by research area.

Blogs on Indoleamine 2,3-dioxygenase/IDO

There are no specific blogs for Indoleamine 2,3-dioxygenase/IDO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Indoleamine 2,3-dioxygenase/IDO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IDO1
Entrez