IMPA2 Antibody - Azide and BSA Free Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
IMPA2 (AAH17176, 1 a.a. - 288 a.a.) full-length human protein. MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK |
| Specificity |
IMPA2 - inositol(myo)-1(or 4)-monophosphatase 2, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
IMPA2 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for IMPA2 Antibody - Azide and BSA Free
Background
IMPA2, also known as Inositol monophosphatase 2, has a 288 amino acid isoform that is 31 kDa and a short 261 amino acid that is 29 kDa, catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling, can use myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates, and serves as possible pharmacological target for lithium Li+ action in brain. Studies are being performed on the relationship of this protein to bipolar disorder, mood disorder, seizures, schizophrenia, febrile seizures, bipolar affective disorder, neisseria meningitides, pneumonia, tuberculosis, neuronitis, schizophrenia and leukemia. The protein has been shown to interact with HERPUD1, TNFRSF1H, INPP1, ISYNA1, and PLCG1 in inositol phosphate metabolism, metabolic pathways and phosphatidylinositol signaling system pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB, IHC
Publications for IMPA2 Antibody (H00003613-B01P) (0)
There are no publications for IMPA2 Antibody (H00003613-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IMPA2 Antibody (H00003613-B01P) (0)
There are no reviews for IMPA2 Antibody (H00003613-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IMPA2 Antibody (H00003613-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IMPA2 Products
Research Areas for IMPA2 Antibody (H00003613-B01P)
Find related products by research area.
|
Blogs on IMPA2