IMPA2 Antibody - Azide and BSA Free

Western Blot: IMPA2 Antibody [H00003613-B01P] - Analysis of IMPA2 expression in transfected 293T cell line by IMPA2 polyclonal antibody. Lane 1: IMPA2 transfected lysate(31.68 KDa). Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: IMPA2 Antibody [H00003613-B01P] - Analysis of purified antibody to IMPA2 on formalin-fixed paraffin-embedded human colon cancer. (antibody concentration 3 ug/ml)

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

IMPA2 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: IMPA2 (AAH17176, 1 a.a. - 288 a.a.) full-length human protein. MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK
• Specificity: IMPA2 - inositol(myo)-1(or 4)-monophosphatase 2,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: IMPA2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IMPA2 Antibody - Azide and BSA Free

• EC 3.1.3.25
• IMP 2
• IMP.18P
• IMPase 2
• inosine monophosphatase 2
• inositol monophosphatase 2 variant 1
• inositol monophosphatase 2 variant 2
• inositol monophosphatase 2
• inositol(myo)-1(or 4)-monophosphatase 2
• Inositol-1(or 4)-monophosphatase 2
• Myo-inositol monophosphatase A2

Background

IMPA2, also known as Inositol monophosphatase 2, has a 288 amino acid isoform that is 31 kDa and a short 261 amino acid that is 29 kDa, catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling, can use myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates, and serves as possible pharmacological target for lithium Li+ action in brain. Studies are being performed on the relationship of this protein to bipolar disorder, mood disorder, seizures, schizophrenia, febrile seizures, bipolar affective disorder, neisseria meningitides, pneumonia, tuberculosis, neuronitis, schizophrenia and leukemia. The protein has been shown to interact with HERPUD1, TNFRSF1H, INPP1, ISYNA1, and PLCG1 in inositol phosphate metabolism, metabolic pathways and phosphatidylinositol signaling system pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IMPA2
• Entrez:
  • 3613(Human)
• Uniprot:
  • AAH17176(Human)