IL-9R Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit IL-9R Antibody - BSA Free (NBP2-68806) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: LTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IL9R |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
Recommended conditions for IHC,Retrieval method: HIER pH6 |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for IL-9R Antibody - BSA Free
Background
The protein encoded by the IL9R gene is a cytokine receptor that specifically mediates the biological effects ofinterleukin 9 (IL9). The functional IL9 receptor complex requires this protein as well as the interleukin 2 receptor,gamma (IL2RG), a common gamma subunit shared by the receptors of many different cytokines. The ligand binding of thisreceptor leads to the activation of various JAK kinases and STAT proteins, which connect to different biologicresponses. This gene is located at the pseudoautosomal regions of X and Y chromosomes. Genetic studies suggested anassociation of this gene with the development of asthma. Multiple pseudogenes on chromosome 9, 10, 16, and 18 havebeen described. Alternatively spliced transcript variants have been found for this gene. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Publications for IL-9R Antibody (NBP2-68806) (0)
There are no publications for IL-9R Antibody (NBP2-68806).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-9R Antibody (NBP2-68806) (0)
There are no reviews for IL-9R Antibody (NBP2-68806).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for IL-9R Antibody (NBP2-68806) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IL-9R Products
Research Areas for IL-9R Antibody (NBP2-68806)
Find related products by research area.
|
Blogs on IL-9R