IL-7 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

IL-7 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL7.
  
  

  Source: E. coli

  Amino Acid Sequence: VSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: IL7
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83111.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-7 Recombinant Protein Antigen

• IL7
• IL-7
• IL-7interleukin-7
• interleukin 7
• Lymphopoietin-1
• PBGF

Background

Interleukin-7 (IL-7, previously known as lymphopoietin-1 and pre-B-cell growth factor) is a hematopoietic growth factor that stimulates early B and T cells. It can also co-stimulate the proliferation of mature T cells with other factors such as ConA (concanavalin A) and IL-2. IL-7 can induce the formation of lymphokine-activated killer (LAK) cells, it also plays a role in the development of cytotoxic T lymphocytes (CTL). IL-7 can stimulate the production of pro-inflammatory cytokines and enhance the tumoricidal activity of monocytes/macrophages. It is produced by thymic stromal cells, spleen cells and keratinocytes. Human and murine IL-7 show cross-species reactivity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: IL7