IL-38/IL-1F10 Antibody


Western Blot: IL1F10 Antibody [NBP1-91501] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

IL-38/IL-1F10 Antibody Summary

Synthetic peptide directed towards the middle region of human IL1F10. Peptide sequence SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against IL1F10 and was validated on Western blot.
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IL-38/IL-1F10 Antibody

  • FIL1- theta
  • FKSG75
  • IL1F10
  • IL-1HY2
  • IL38
  • IL-38
  • interleukin 1 family, member 10 (theta)
  • UNQ6119/PRO20041


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu
Applications: WB, IHC, Block, Neut
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IL-38/IL-1F10 Antibody (NBP1-91501) (0)

There are no publications for IL-38/IL-1F10 Antibody (NBP1-91501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-38/IL-1F10 Antibody (NBP1-91501) (0)

There are no reviews for IL-38/IL-1F10 Antibody (NBP1-91501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-38/IL-1F10 Antibody (NBP1-91501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for IL-38/IL-1F10 Antibody (NBP1-91501)

Discover related pathways, diseases and genes to IL-38/IL-1F10 Antibody (NBP1-91501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-38/IL-1F10 Antibody (NBP1-91501)

Discover more about diseases related to IL-38/IL-1F10 Antibody (NBP1-91501).

Pathways for IL-38/IL-1F10 Antibody (NBP1-91501)

View related products by pathway.

PTMs for IL-38/IL-1F10 Antibody (NBP1-91501)

Learn more about PTMs related to IL-38/IL-1F10 Antibody (NBP1-91501).

Blogs on IL-38/IL-1F10

There are no specific blogs for IL-38/IL-1F10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IL-38/IL-1F10 Antibody and receive a gift card or discount.


Gene Symbol IL1F10