IL-32 Antibody - BSA Free

Western Blot: IL-32 Antibody [NBP1-82560] - Analysis in control (vector only transfected HEK293T lysate) and IL32 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: IL-32 Antibody [NBP1-82560] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in non - germinal center cells.

Immunohistochemistry-Paraffin: IL-32 Antibody [NBP1-82560] - Staining of human lymph node shows distinct cytoplasmic positivity in subsets of lymphoid cells.

Immunohistochemistry-Paraffin: IL-32 Antibody [NBP1-82560] - Staining of human gastrointestinal shows moderate to strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: IL-32 Antibody [NBP1-82560] - Staining of human skin shows strong cytoplasmic positivity in Langerhans cells.

Immunohistochemistry-Paraffin: IL-32 Antibody [NBP1-82560] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-32 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IL-32 Antibody - BSA Free (NBP1-82560) is a polyclonal antibody validated for use in IHC and WB. Anti-IL-32 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL32
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 25100201). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IL-32 Protein (NBP1-82560PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IL-32 Antibody - BSA Free

• IL32
• IL-32
• IL-32alpha
• IL-32beta
• interleukin 32
• interleukin-32 theta
• interleukin-32
• natural killer cell transcript 4
• Natural killer cells protein 4
• NK4
• NK4IL-32delta
• TAIF
• TAIFa
• TAIFb
• TAIFc
• TAIFd
• TAIFIL-32gamma
• Tumor necrosis factor alpha-inducing factor

Background

IL32 alfa is the shortest of the 4 isotypes of IL32 known, it is 134 amino acids ( kDa) protein, the IL32B (beta) is 188, IL32C is 168 and IL32D is 179 amino acids long proteins. Each subtype has an N-terminal segment and four kringle domains (NK4), that interact with several other proteins including the hepatic growth factor via c-met a tyrosine receptor kinase (5). IL-32 synergized with the intracellular nuclear oligomerization domain receptors (NOD1- and NOD2-specific muropeptides of peptidoglycans for the release of IL-1beta and IL-6. In contrast, IL-32 did not influence the cytokine production induced via TLRs (6). The anti-IL32 selective antibodies were made against an epitope that lies near the C-terminal end of the protein. The antibodies to IL32 are affinity purified on immobilized affinity based chromatography and characterized for applications in ELISA and Western blotting. The antiIL32 antibodies recognize a single band of IL32 in PC-IL32 samples. The IL32 antibodies do not cross react with other pro-inflammatory or anti-inflammatory interleukins, has also produced antibodies to other interleukins, interleukin receptors, cytokines and their receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IL-32 Antibody (NBP1-82560)(1)

Publication using NBP1-82560

• Player A, Oguamanam T, Okanmelu J et al. Preliminary characterization of IL32 in basal-like/triple negative compared to other types of breast cell lines and tissues. BMC Res Notes 2014-01-01 [PMID: 25100201] (WB)

Bioinformatics

• Gene Symbol: IL32