Recombinant Human IL-23A/IL-23 P19 Protein

Images

 
SDS-Page: Recombinant Human IL-23A/IL-23 P19 Protein [H00051561-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human IL-23A/IL-23 P19 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-189 of Human IL23A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
IL23A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
47.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00051561-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IL-23A/IL-23 P19 Protein

  • IL-23 p19/IL-12 p40
  • IL23
  • IL-23
  • IL-23A
  • IL-23-A
  • IL-23p19
  • IL-23p19/IL-12p40
  • IL23P19P19
  • interleukin 23 p19 subunit
  • interleukin 23, alpha subunit p19
  • interleukin-23 subunit alpha
  • Interleukin-23 subunit p19
  • JKA3 induced upon T-cell activation
  • MGC79388
  • SGRF
  • SGRFIL-23 subunit alpha

Background

This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01)(1)

Reviews for IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01) (0)

There are no reviews for IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01)

Discover related pathways, diseases and genes to IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01)

Discover more about diseases related to IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01).
 

Pathways for IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01)

View related products by pathway.

PTMs for IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01)

Learn more about PTMs related to IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01).
 

Research Areas for IL-23A/IL-23 P19 Recombinant Protein (H00051561-P01)

Find related products by research area.

Blogs on IL-23A/IL-23 P19

There are no specific blogs for IL-23A/IL-23 P19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IL-23A/IL-23 P19 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IL23A