IL-21R Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-21 R Antibody [NB100-739] - Immunohistochemistry on mouse thymus with rabbit antibody to N-terminus of mouse IL-21 receptor.

Product Discontinued

IL-21R Antibody - BSA Free Summary

• Immunogen: Synthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF, corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor.
• Localization: Cell Membrane
• Specificity: IL21 Receptor
• Predicted Species: Human (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL21R
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2)
• Preservative: 0.1% Sodium Azide
• Concentration: 1.0 mg/ml
• Purity: Immunogen affinity purified

Alternate Names for IL-21R Antibody - BSA Free

• CD360 antigen
• CD360
• IL-21 R
• IL-21 receptor
• IL21R
• IL-21R
• interleukin 21 receptor
• interleukin-21 receptor
• MGC10967
• NILR
• Novel interleukin receptor

Background

The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2 (IL2) and interleukin 5 (IL5). This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants encoding the same protein have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL21R
• Entrez:
  • 60504(Mouse)