IL-17B Antibody - BSA Free

Western Blot: IL17B Antibody [NBP1-83113] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: IL17B Antibody [NBP1-83113] - Staining of human spleen shows moderate nuclear positivity in cells in red pulp.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-17B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IL-17B Antibody - BSA Free (NBP1-83113) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL17B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IL-17B Protein (NBP1-83113PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IL-17B Antibody - BSA Free

• Cytokine Zcyto7
• cytokine-like protein ZCYTO7
• IL17B
• IL-17B
• IL-17Binterleukin-17 beta
• IL20
• IL-20interleukin-17B
• interleukin 17B
• interleukin 20
• Interleukin-20
• MGC138900
• MGC138901
• neuronal interleukin-17 related factor
• Neuronal interleukin-17-related factor
• NIRF
• ZCYTO7interleukin-20

Background

Recently, a number of cytokines belonging to the interleukin (IL)-17 family have been identified. These are IL-17B, IL-17C, and IL-17E. Like IL-17, IL-17B, C, and E are able to induce proinflammatory responses but don't bind to the IL-17 receptor suggesting additional IL-17R related receptors might exist. IL-17E induces activation of NF-kB pathway and like IL-17 also induces production of IL-8. IL-17Rh1 mRNA is highly expressed in kidney and liver and at moderate level in small intestine, colon, and brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL17B