IL-16 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
IL16 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for IL-16 Antibody
Background
Interleukin-16 (IL-16, also known as lymphocyte chemoattractant factor (LCF)) is a CD8+ T cell-derived cytokine. It acts as a chemoattractant for CD4+ T-cells, monocytes and eosinophils. IL-16 has also been shown to suppress HIV-1 replication in vitro. It is expressed as a precursor molecule (pro-IL-16) in various tissues including spleen, thymus, lymph nodes, peripheral leukocytes, bone marrow and cerebellum. The active form is assumed to be a proteolytic cleavage product of pro-IL-16 existing, under physiological conditions, predominantly as a noncovalently linked multimer. The sequence and structure of IL-16 is conserved across species, human and murine IL-16 show significant cross-species reactivity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: ELISA
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Mu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Publications for IL-16 Antibody (NBP3-21240) (0)
There are no publications for IL-16 Antibody (NBP3-21240).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-16 Antibody (NBP3-21240) (0)
There are no reviews for IL-16 Antibody (NBP3-21240).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IL-16 Antibody (NBP3-21240) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IL-16 Products
Bioinformatics Tool for IL-16 Antibody (NBP3-21240)
Discover related pathways, diseases and genes to IL-16 Antibody (NBP3-21240). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for IL-16 Antibody (NBP3-21240)
Discover more about diseases related to IL-16 Antibody (NBP3-21240).
| | Pathways for IL-16 Antibody (NBP3-21240)
View related products by pathway.
|
Research Areas for IL-16 Antibody (NBP3-21240)
Find related products by research area.
|
Blogs on IL-16