IL-11R alpha Antibody

Images

 
Western Blot: IL11RA Antibody [NBP1-62351] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry-Paraffin: IL-11R alpha Antibody [NBP1-62351] - The effect of anti-human IL11Ralpha antibody combination treatment with doxorubicin on AN3CA xenograft tumour morphology in vivo. Representative ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-11R alpha Antibody Summary

Immunogen
Synthetic peptides corresponding to IL11RA(interleukin 11 receptor, alpha) The peptide sequence was selected from the middle region of IL11RA. Peptide sequence FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA. The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: alpha.
Predicted Species
Rat (100%), Canine (93%), Equine (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL11RA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
This is a rabbit polyclonal antibody against IL11RA and was validated on Western blot. Use in Immunohistochemistry paraffin reported in scientific literature (PMID 28186993).
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-62351 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28186993).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IL-11R alpha Antibody

  • AI314697
  • GP130
  • IL-11 R alpha
  • IL11R alpha
  • IL11RA
  • IL-11Ra
  • Il11ra2
  • NR1

Background

Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. IL11RA is the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain.Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. This gene encodes the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain. Alternative splicing has been observed at this locus and two variants, each encoding a distinct isoform, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-27406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
NBP2-22471
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
AF-249-NA
Species: Hu
Applications: WB, Neut
NB100-1774
Species: Hu, Mu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IHC-Fr, IHC-P, IP, IHC-FrFl, KO
AF-303-NA
Species: Hu
Applications: WB, Neut

Publications for IL-11R alpha Antibody (NBP1-62351)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for IL-11R alpha Antibody (NBP1-62351) (0)

There are no reviews for IL-11R alpha Antibody (NBP1-62351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-11R alpha Antibody (NBP1-62351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IL-11R alpha Products

Bioinformatics Tool for IL-11R alpha Antibody (NBP1-62351)

Discover related pathways, diseases and genes to IL-11R alpha Antibody (NBP1-62351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-11R alpha Antibody (NBP1-62351)

Discover more about diseases related to IL-11R alpha Antibody (NBP1-62351).
 

Pathways for IL-11R alpha Antibody (NBP1-62351)

View related products by pathway.

PTMs for IL-11R alpha Antibody (NBP1-62351)

Learn more about PTMs related to IL-11R alpha Antibody (NBP1-62351).
 

Research Areas for IL-11R alpha Antibody (NBP1-62351)

Find related products by research area.

Blogs on IL-11R alpha

There are no specific blogs for IL-11R alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-11R alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL11RA
Entrez
Uniprot