IL-11R alpha Antibody (10Z3S9)

Western Blot: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Western blot analysis of extracts of various cell lines, using (NBP3-16809) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Western Blot: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Western blot analysis of extracts of Rat brain, using (NBP3-16809) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunocytochemistry/ Immunofluorescence: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Confocal imaging of K-562 cells using IL-11R alpha Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Immunohistochemistry analysis of IL-11R alpha in paraffin-embedded human colon tissue using IL-11R alpha Rabbit mAb at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Immunohistochemistry analysis of IL-11R alpha in paraffin-embedded mouse brain tissue using IL-11R alpha Rabbit mAb at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Immunohistochemistry analysis of IL-11R alpha in paraffin-embedded rat spleen tissue using IL-11R alpha Rabbit mAb at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Immunohistochemistry analysis of IL-11R alpha in paraffin-embedded human liver cancer tissue using IL-11R alpha Rabbit mAb at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: IL-11R alpha Antibody (10Z3S9) [NBP3-16809] - Confocal imaging of RAW 264.7 cells using IL-11R alpha Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 10Z3S9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

IL-11R alpha Antibody (10Z3S9) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 323-422 of human IL-11R alpha (Q14626). EIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRDSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAPNL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: IL11RA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IL-11R alpha Antibody (10Z3S9)

• AI314697
• GP130
• IL-11 R alpha
• IL11R alpha
• IL11RA
• IL-11Ra
• Il11ra2
• NR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL11RA